SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027233 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027233
Domain Number 1 Region: 26-205
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 3.04e-82
Family MHC antigen-recognition domain 0.000000033
Further Details:      
 
Domain Number 2 Region: 210-300
Classification Level Classification E-value
Superfamily Immunoglobulin 8.84e-30
Family C1 set domains (antibody constant domain-like) 0.0000209
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027233   Gene: ENSGGOG00000005772   Transcript: ENSGGOT00000022877
Sequence length 371
Comment pep:known chromosome:gorGor3.1:6:30871632:30967560:1 gene:ENSGGOG00000005772 transcript:ENSGGOT00000022877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVVAPRTLLLLLSGALALTQTWAGSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRF
DSDAASQRMEPRAPWMEQEEPEYWDRQTQISKTNAQIELESLRIALRYYNQSEDGSHTIQ
RMYGCDVGSDGRFLRGYQQDAYDGKDYIASNEDLRSWTAADMAAEITKRKWEAAHFAEQL
RAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHPVSDHEAILRCWALSFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRWEP
SSQPTIPIVGIIAGLVLFGAVIAGAVVAAVRWRRKSSGGEGVKDRKGGSYSQAASSDSAQ
GSDVSLTACKV
Download sequence
Identical sequences ENSGGOP00000027233 ENSGGOP00000005655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]