SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027247 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027247
Domain Number 1 Region: 340-688
Classification Level Classification E-value
Superfamily L domain-like 2.83e-46
Family Ngr ectodomain-like 0.019
Further Details:      
 
Domain Number 2 Region: 29-330
Classification Level Classification E-value
Superfamily L domain-like 2.38e-44
Family Ngr ectodomain-like 0.033
Further Details:      
 
Domain Number 3 Region: 750-902
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.96e-31
Family Toll/Interleukin receptor TIR domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027247   Gene: ENSGGOG00000023623   Transcript: ENSGGOT00000024905
Sequence length 905
Comment pep:novel chromosome:gorGor3.1:4:196909821:196926170:1 gene:ENSGGOG00000023623 transcript:ENSGGOT00000024905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMRQTLPCIYFWGGLLPFGMLCASSTTKCTVSHEVADCSHLKLTQIPDDLPTNITVLNLT
HNQLRRLPAANFTRYSQLTSLDVGFNTISKLEPELCQKLPMLKVLNLQHNELSQLSDKTF
AFCTNLTELHLMSNSIQKIKNNPFVKQKNLITLDLSHNGLSSTKLGTQVQLENLQELLLS
NNKIQALKSEELYIFANSSLKKLELSSNQIKEFSPGCFYAIGRLFGLFLNNVQLGPSLTE
KLCLELANTSIRNLSLSNSQLSTTSNTTFLGLKWTNLTMLDLSYNNLNVVGNDSFAWLPH
LEYFFLEYNNIQHLFSHSLHGLFNVRYLNLKRSFTKQSISLASLPKIDDFSFQWLKCLEH
LNMEDNDIPGIKSNMFTGLINLKYLSLSNSFTSLRTLTNETFVSLAHSPLHILNLTKNKI
SKIESDAFSWLGHLEVLDLGLNEIGQELTGQEWRGLENIFEIYLSYNKYLQLTRNSFALV
PSLQRLMLRRVALKNVDSSPSPFQPLRNLTILDLSNNNIANINDDMLEGLEKLEILDLQH
NNLARLWKHANPGGPVYFLKGLSHLHILNLESNGFDEIPVEVFKDLSELKIIDLGLNNLN
TLPASVFNNQVSLKSLNLQKNLITSVEKKVFGPAFRNLTELDMRFNPFDCTCESIAWFVN
WINETHTNIPELSSHYLCNTPPHYHGFPVRLFDTSSCKDSAPFELFFMINTSILLIFIFI
VLLIHFEGWRISFYWNVSVHRVLGFKEIDRQTEQFEYAAYIIHAYKDKDWVWEHFSSMEK
EDQSLKFCLEERDFEAGVFELEAIVNSIKRSRKIIFVITHHLLKDPLCKRFKVHHAVQQA
IEQNLDSIILVFLEEIPDYKLNHALCLRRGMFKSHCILNWPVQKERIGAFRHKLQVALGS
KNSVH
Download sequence
Identical sequences ENSGGOP00000027247 ENSGGOP00000027247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]