SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027414 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027414
Domain Number 1 Region: 47-172
Classification Level Classification E-value
Superfamily HSP20-like chaperones 6.28e-28
Family Co-chaperone p23-like 0.00011
Further Details:      
 
Domain Number 2 Region: 272-417
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.15e-23
Family AlaX-like 0.017
Further Details:      
 
Domain Number 3 Region: 213-269
Classification Level Classification E-value
Superfamily Translation proteins 0.000000000424
Family AlaX-M N-terminal domain-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027414   Gene: ENSGGOG00000006250   Transcript: ENSGGOT00000032310
Sequence length 586
Comment pep:novel chromosome:gorGor3.1:5:41067274:41081256:1 gene:ENSGGOG00000006250 transcript:ENSGGOT00000032310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSLPLNCSPDHIRRGSCWGRPQDLKIAAPAWNSKCHPGAGAAMARQHARTLWYDRPRYV
FMEFCVEDSTDVHVLIEDHRIVFSCKNADGVELYNEIEFYAKVNSKDSQDKRSSRSITCF
VRKWKEKVAWPRLTKEDIKPVWLSVDFDNWRDWEGDEEMELAHVEHYAELLKKVSTKRPP
PAMDDLDFTTTVVSCCPAELQTEGSNGKKEVLSGFQVVLEDTLLFPEGGGQPDDRGTIND
ISVLRVTRRGEQADHFTQTPLDPGSQVLVRVDWERRFDHMQQHSGKGWDGGLRYVICGHC
TSDRELGRFRSAIELDTPSMTAEQVAAIEQSVNEKIRDRLPVNVRELSLDDPEVEQVSGR
GLPDDHAGPIRVVSIEGVDSNMCCGTHVSNLSDLQVIKILGTEKGKKNRTNLIFLAGNRV
LKWMERSHGTEKALTALLKCGTEDHVEAVKKLQNSTKILQKNNLNLLRDLAVHIAHSLRN
SPDWGGVVVLHRKEGDSEFMNIIANEIGSEETLLFLTVGDEKGAGLFLLAGPPASLETLG
PRVAEVLEGKGAGKKGRFQGKATKMSRRMEAQALLQDYISTQSAKE
Download sequence
Identical sequences ENSGGOP00000027414 ENSGGOP00000006121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]