SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027423 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027423
Domain Number 1 Region: 11-112
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.09e-19
Family DEP domain 0.02
Further Details:      
 
Domain Number 2 Region: 224-298,581-675
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00000000895
Family BCR-homology GTPase activation domain (BH-domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027423   Gene: ENSGGOG00000028211   Transcript: ENSGGOT00000024382
Sequence length 804
Comment pep:novel chromosome:gorGor3.1:9:87921149:87923732:1 gene:ENSGGOG00000028211 transcript:ENSGGOT00000024382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESWGVPPRPYLATKLWNEITTSFRAGMPLRKHRQHFKKYGSCFTAGEAVDWLYDLLRNN
NSFGPKVTRQQTIQLLRKFLKNHVIEDIKGRWGSENVDGTNQLFRFLATPFKTLPRRHPE
LRKNNIENFPKDKDSIFKRNLSCRTPKKHGLHLSQENSEKIKHEIINEDQENADDNRKLS
QEDVEEMWRYVILIYLQAILGVPSLEEVINPKQVIPQYIMYNMANTSKHGVVILQNKSDD
LPHWVLSAMKCLANWPRSDDMNNPTYVGFEQDIFSTITDYFLDLLEPLLTFEYYELFVNI
LVVCGYVIVSYRSSGIHRIQDDPQSKFLHNLNSFKSMECLLLSLLHREKEESDSTERLRI
SNPGFQERCAKKMQLVNLRNRGVSANDIMGGSCHNLIGLSGMHDLSSNSKLSCCSLEGIV
DVSGNSSKEASSVKRHQSPNIEGQNTKLFLESKPKQEFLLNLHSEENIQKPFRAGFKRTT
TLTAQDQEELCNGKCKSKQLCRSQSLLLRSSTRRNSCINTPLAEMIMKPNVGQSSTSVQT
AMQSELGESSAAINKRLCKSSIEFSENSLLPASSVLTGTRSLLQPHLERVAIDGLQLCRL
LLPPPNCRKLQLLMRMISQMSQNVDMPKLHDAMGMKSPMIHTFSRCVLCCAEKVDLDKLL
AGRLVSFLMDHHQEILQVPTYLQTAVEKHLEYLKKGHIENPGDGLFVPLPTYSYCKQISA
QDFEKQKVSTSQAAITELLDNVIKNKSLPLKEKRKNLKQFQKEYPLIYQKRFPTTESEAA
LFGDKPTIKQPMLILRKPKFCSLR
Download sequence
Identical sequences ENSGGOP00000027423 ENSGGOP00000027423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]