SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027506 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027506
Domain Number 1 Region: 27-79
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000334
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 2 Region: 93-153
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000917
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000027506
Domain Number - Region: 3-30
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0403
Family Complement control module/SCR domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027506   Gene: ENSGGOG00000027113   Transcript: ENSGGOT00000025404
Sequence length 154
Comment pep:novel chromosome:gorGor3.1:1:187724946:187729572:1 gene:ENSGGOG00000027113 transcript:ENSGGOT00000025404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KDPPRVQCQALNKWEPELPSCSRDLQLPPEILHGEHTLSHQDNFSPGQEVFYSCEPGYDL
RGAASLHCMPQGDWTPEAPRFLLLLFYFFVKSCDDFLGQLPHGRVLFPLNLQLGAKVSFV
CDEGFQKGSSRSASHCVLAGMKALWNSSVPVCER
Download sequence
Identical sequences ENSGGOP00000027506 ENSGGOP00000017308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]