SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027534 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027534
Domain Number 1 Region: 324-402
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 3.31e-23
Family Intermediate filament protein, coiled coil region 0.0000315
Further Details:      
 
Domain Number 2 Region: 95-131
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000000000502
Family Intermediate filament protein, coiled coil region 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027534   Gene: ENSGGOG00000025284   Transcript: ENSGGOT00000033742
Sequence length 470
Comment pep:novel chromosome:gorGor3.1:12:47236958:47241941:1 gene:ENSGGOG00000025284 transcript:ENSGGOT00000033742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHHPSGLRAGFSSTSYRRTFGPPPSLSPGAFSYSSSSRFSSSRLLGSASPSSSVRLGSF
RSPRAGAGALLRLPSERLDFSMAEALNQEFLATRSNEKQELQELNDRFANFIEKVRFLEQ
QNAALRGELSQARGQEPARADQLCQQELRELRRELELLGRERDRVQVERDGLAEDLAALK
QRLEEETRKREDAEHNLVLFRKDVDDATLSRLELERKIESLMDEIEFLKKLHEEELRDLQ
VSVESQQVQQVEVEATVKPELTAALRDIRAQYESIAAKNLQEAEEWYKSKYADLSDAANR
NHEALRQAKQEMNESRRQIQSLTCEVDGLRGTNEALLRQLRELEEQFALEAGGYQAGAAR
LEEELRQLKEEMARHLREYQELLNVKMALDIEIATYRKLLEGEESRISVPVHSFASLNIK
TTVPEVEPPQDSHSRKTVLIKTIETRNGEVVTESQKEQRSELDKSSAHSY
Download sequence
Identical sequences A0A2J8LPX5 P41219
ENSPTRP00000008377 ENSP00000257860 NP_006253.2.87134 NP_006253.2.92137 XP_004053136.1.27298 XP_016778974.1.37143 ENSP00000257860 ENSGGOP00000027534 gi|21264345|ref|NP_006253.2| ENSGGOP00000027534 ENSP00000257860 9598.ENSPTRP00000008377 9606.ENSP00000257860 ENSPTRP00000008377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]