SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027539 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027539
Domain Number 1 Region: 288-621
Classification Level Classification E-value
Superfamily L domain-like 9.64e-43
Family Ngr ectodomain-like 0.02
Further Details:      
 
Domain Number 2 Region: 684-835
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.79e-35
Family Toll/Interleukin receptor TIR domain 0.00021
Further Details:      
 
Domain Number 3 Region: 23-249
Classification Level Classification E-value
Superfamily L domain-like 2.44e-27
Family Ngr ectodomain-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027539   Gene: ENSGGOG00000028152   Transcript: ENSGGOT00000028556
Sequence length 858
Comment pep:novel chromosome:gorGor3.1:1:203555946:203583304:-1 gene:ENSGGOG00000028152 transcript:ENSGGOT00000028556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDHLDLLLGVVLMAGPVFGIPSCSFDGRIAFYRFCNLTQVPQVLNTTERLLLSFNYIRT
VTASSFPFLEQLQLLELGSQYTPLTIDKEAFRNLPNLRILDLGSSKIYFLHPDAFQGLFH
LFELRLYFCGLSDAVLKDGYFRNLKALTRLDLSKNQIRSLYLHPSFGKLNSLKSIDFSSN
QIFLVCEHELEPLQGKTLSFFSLAANSLYSRVSVDWGKCMNPFRNMVLEILDVSGNGWTV
DITGNFSNAISKSQAFSLILAHHIMGAGFGFHNIKDPDQSTFAGLARSSVRHLDLSHGFV
FSLNSRVFETLKDLKVLNLAYNKINKIADEAFYGLDNLQVLNLSYNLLGELYSSNFYGLP
KVAYIDLQKNHIGIIQDQTFKFLEKLQTLDLRDNALTTIHFIPSIPDIFLSGNKLVTLPK
INLTANLIHLSENRLENLDILYFLLRVPHLQILILNQNRLSSCSGDQTPSENPSLERLFL
GENMLQLAWETELCWDVFEGLSHLQVLYLNNNYLNSLPPGVFSHLTALRGLSLNSNRLTV
LSHNDLPANLEILDISRNQLLAPDPDVFVSLSVLDITHNKFICECELSTFINWLNHTNVT
IAGPPADIYCVYPDSLSGVSLFSLSTEGCDEEEVLKSLKFSLFIVCTVTLTLFLMTILTV
TKFRGFCFICYKTAQRLVFKDHPQGTEPDMYKYDAYLCFSSKDFTWVQNALLKHLDSQYS
DQNRFNLCFEERDFVPGENRIANVQDAIWNSRKIVCLVSRHFLRDGWCLEAFSYAQGRCL
SDLNSALIMVVVGSLSQYQLMKHQSIRGFVQKQQYLRWPEDLQDVGWFLHKLSQQILKKE
KEKKKDNNIPLQTVATIS
Download sequence
Identical sequences S5Q2R4
ENSGGOP00000027539 ENSGGOP00000027539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]