SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027645 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027645
Domain Number 1 Region: 106-299
Classification Level Classification E-value
Superfamily vWA-like 3.41e-52
Family Integrin A (or I) domain 0.0000000115
Further Details:      
 
Domain Number 2 Region: 1-87,278-481,535-604
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 5.23e-43
Family Integrin alpha N-terminal domain 0.0006
Further Details:      
 
Domain Number 3 Region: 607-750
Classification Level Classification E-value
Superfamily Integrin domains 1.94e-33
Family Integrin domains 0.00091
Further Details:      
 
Domain Number 4 Region: 753-879
Classification Level Classification E-value
Superfamily Integrin domains 4.03e-22
Family Integrin domains 0.01
Further Details:      
 
Domain Number 5 Region: 885-1083
Classification Level Classification E-value
Superfamily Integrin domains 0.0000000314
Family Integrin domains 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027645   Gene: ENSGGOG00000022320   Transcript: ENSGGOT00000029300
Sequence length 1117
Comment pep:novel chromosome:gorGor3.1:17:44295275:44456621:-1 gene:ENSGGOG00000022320 transcript:ENSGGOT00000029300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLIGSPLVGQPKNRTGDVYKCPVGRGESLPCVKLDLPVNTSIPNVTEVKENMTFGSTLVT
NPNGGFLACGPLYAYRCGHLHYTTGICSDVSPTFQVVNSIAPVRECSTQLDIVIVLDGSN
SIYPWDSVTAFLNDLLERMDIGPKQTQVGIVQYGENVTHEFNLNKYSSTEEVLVAAKKIV
QRGGRQTMTALGIDTARKEAFTEARGARRGVKKVMVIVTDGESHDNHRLKKVIQDCEDEN
IQRFSIAILGSYNRGNLSTEKFVEEIKSIASEPTEKHFFNVSDELALVTIVKTLGERIFA
LEATADQSAASFEMEMSQTGFSAHYSQDWVMLGAVGAYDWNGTVVMQKASQIIIPRNTTF
NVESTKKNEPLASYLGYTVNSATASSGDVLYIAGQPRYNHTGQVIIYRMEDGNIKILQTL
SGEQIGSYFGSILTTIDIDKDSNTDILLVGAPMYMGTEKEEQGKVYVYALNQVMVSEFGR
NPGKSLPSRSFRESFLSEQNKFSLCTILGEEGIVAQIKDIINFTNFTTNVQMAVNSTDLS
NTLFLQHQSFKKMRRTFSQRIPSGGDGETLKFFGQSIHGEMDLNGDGLTDVTIGGLGGAA
LFWSRDVAVVKVTMNFEPNKVNIQKKNCHMEGKETVCINATVCFDVKLKSKEDTIYEADL
QYRVTLDSLRQISRSFFSGTQERKVQRNITVRKSECTKHSFYMLDKHDFQDSVRITLDFN
LTDPENGPVLDDSLPNSVHEYIPFAKDCGNKEKCVSDLSLHVATTEKDLLIVRSQNDKFN
VSLTVKNTKDSAYNTRTIVHYSPNLVFSGIEAIQKDSCESNHNITCKVGYPFLRRGEMVT
FKILFQFNTSYLMENVTIYLSATSDSEEPPETLSDNVVNISIPVKYEVGLQFYSSASEYH
ISIAANETVPEVINSTEDIGNEINIFYLIRKSGSFPMPELKLSISFPNMTSNGYPVLYPT
GLSSSDHDTCNKEFYQSNMERLSVLSLVCRESKVLLDEYINTDEGLSLFNCFMSHNIEQV
FLNVVVSCLATLKSYFSSLNLTIRGELRSENASLVLSSSNQKRELAIQISKDGLPGTVPL
WVILLSAFAGLLLLMLLILALWKIGFFKRPLKKKMEK
Download sequence
Identical sequences ENSGGOP00000017850 ENSGGOP00000027645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]