SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027736 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027736
Domain Number 1 Region: 328-555
Classification Level Classification E-value
Superfamily L domain-like 3.29e-35
Family Ngr ectodomain-like 0.0027
Further Details:      
 
Domain Number 2 Region: 68-267
Classification Level Classification E-value
Superfamily L domain-like 3.97e-34
Family Ngr ectodomain-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027736   Gene: ENSGGOG00000023334   Transcript: ENSGGOT00000026924
Sequence length 841
Comment pep:novel chromosome:gorGor3.1:13:68722978:68730460:-1 gene:ENSGGOG00000023334 transcript:ENSGGOT00000026924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLWIHLFYSSLLACISLHSQTPVFSSRGSCDSLCNCEEKDGTMLINCEAKGIKMVSEIS
VPPSRPFQLSLLNNGLTMLHTNDFSGLTNAISIHLGFNNIADIEIGAFNGLGLLKQLHIN
HNSLEILKEDTFHGLENLEFLQADNNFITVIEPNAFSKLNRLKVLILNDNAIESLPPNIF
RFVPLTHLDLRGNQLQTLPYVGFLEHIGRILDLQLEDNKWACNCDLLQLKTWLENMPPQS
IIGDVVCNSPPFFKGSILSRLKKESICPAPPVYEEHEDPSGSLYLAATSSINDSRMSTKT
TSILKLPTRAPGLIPYITKPSTQLPGPYCPIPCNCKVLSPSGLLIHCQERNIESLSDLRP
PPQNPRKLILAGNIIHSLMKSDLVEYFTLEMLHLGNNRIEVLEEGSFMNLTRLQKLYLNG
NHLTKLSKGMFLGLHNLEYLYLEYNAIKEILPGTFNPMPKLKVLYLNNNLLQVLPPHIFS
GVPLTKVNLKTNQFTHLPVSNILDDLDLLTQIDLEDNPWDCSCDLVGLQQWIQKLSKNTV
TDDILCTSPRHLDKKELKALNSEILCPGLVNNPSMPTQTSYIIVTTPATTTNTADTILRS
LTDAVPLSVLILGLLIVFITIVFCAAGIVVLVLHRRRRYKKKQVDEQMRDNSPVHLQYSM
YGHKTTHHTTERPSASLYEQHMVSPMVHVYRSPSFGPKHLEEEEERNEKEGSDAKHLQRS
LLERENHSPLTGSNMKYKTMNQSTEFLSFQDASSLYRNILEKERELQQLGITEYLRKNIA
QLQPDMEAHYPGAHEELKLMETLMYSRPRKVLVEQTKNEYFELKANLHAEPDYLEVLEQQ
T
Download sequence
Identical sequences ENSGGOP00000027736 ENSGGOP00000027736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]