SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027790 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027790
Domain Number 1 Region: 343-413
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.44e-22
Family Intermediate filament protein, coiled coil region 0.00093
Further Details:      
 
Domain Number 2 Region: 102-135
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000152
Family Intermediate filament protein, coiled coil region 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027790   Gene: ENSGGOG00000016860   Transcript: ENSGGOT00000029344
Sequence length 456
Comment pep:novel chromosome:gorGor3.1:5:42667949:42672883:1 gene:ENSGGOG00000016860 transcript:ENSGGOT00000029344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSFYSTSSCPLGCTMAPGARNVSVSPIDVGCQPGAEANIAPMCLLANVAHANRVRVGST
PLGRPSLCLPPTCHTACPLPGTCHIPGNIGICGAYGENTLNGHEKETMQFLNDRLANYLE
KVRQLEQENAELEATLLERSKCHESTVCPDYQSYFRTIEELQQKILCSKAENARLIVQID
NAKLAADDFRIKLESERSLRQLVEADKCGTQKLLDDATLAKADLEAQQESLKEEQLSLKS
NHEQEVKILRSQLGEKLRIELDIEPTIDLNRVLGEMRAQYEAMLETNRQDVEQWFQAQSE
GISLQAMSCSEELQCCQSEILELRCTVNALEVERQAQHTLKDCLQNSLCEAEDRFGTELA
QMQSLISNVEEQLSEIRADLERQNQEYQVLLDVKTRLENEIATYRNLLESEDCKLPCNPC
STPPSCVTAPCAPRPSCGLCTTCGPTCGASTTGSRF
Download sequence
Identical sequences ENSGGOP00000027790 ENSGGOP00000027790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]