SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027868 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027868
Domain Number 1 Region: 338-415
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 7.85e-21
Family Intermediate filament protein, coiled coil region 0.00051
Further Details:      
 
Domain Number 2 Region: 110-143
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000889
Family Intermediate filament protein, coiled coil region 0.0014
Further Details:      
 
Domain Number 3 Region: 8-76,425-479
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000565
Family Growth factor receptor domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000027868
Domain Number - Region: 231-363
Classification Level Classification E-value
Superfamily Typo IV secretion system protein TraC 0.000955
Family Typo IV secretion system protein TraC 0.019
Further Details:      
 
Domain Number - Region: 147-216
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00282
Family Intermediate filament protein, coiled coil region 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027868   Gene: ENSGGOG00000006602   Transcript: ENSGGOT00000025496
Sequence length 487
Comment pep:novel chromosome:gorGor3.1:12:50267372:50275454:-1 gene:ENSGGOG00000006602 transcript:ENSGGOT00000025496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCLYSRLSAPCGVRAFSCISACGPRPGRCCITAAPYRGVSCYRGLTGGFGSHSVCGGFR
AGSCGRSFGYRSGGVCGPSPPCITTVSVNESLLMPLNLEIDPNAQCVKQEEKEQIKSLNS
RFAAFIDKVRFLEQQNKLLELQFFQNRECCESNLEPLFEGYITTQRREAECVEADSGRLA
SELNHVQEVLEGYKKKYEEEVALRATAENEFVALKKDVDCAYLRKSDLEANVEALTQEID
FLRRLYEEEIRILQSHISDTSVVVKMDNSRDLNMHCVVTEIKAQYDDIATRSRAEAESWY
RSKCEEMKATVIRHGETLRRTKEEINELNRMIQRLTAEVENAKGQNSKLEAAVAQSEQQG
EAALSDARCKLVELEGTLQKAKQDMACLIREYQEVMNSKLGLDIEIATYRRLLEGEEQRL
CEGVGAVNVCVSSSRGGVLCGDLCVSGSRPVTGSVCSAPCSGNVAVSTGLCAPCGQSCRS
GRSVRFA
Download sequence
Identical sequences ENSGGOP00000027868 ENSGGOP00000006460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]