SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027870 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027870
Domain Number 1 Region: 160-313
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.16e-36
Family BCR-homology GTPase activation domain (BH-domain) 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027870   Gene: ENSGGOG00000026122   Transcript: ENSGGOT00000024468
Sequence length 586
Comment pep:novel chromosome:gorGor3.1:2a:97864467:97866428:1 gene:ENSGGOG00000026122 transcript:ENSGGOT00000024468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKCFLPPTSSPSEHHRLEHGSGLTQTLSSEEISPTKFPGLYHTGEPSPPHDILHKPPDI
VSDDEKDHGKKKGNFKKKEKRTEGYAAFQEDSSGDEAESPSKMRRPKGIHVFKNPSFSFQ
EPEVPEIDVPSLKPIFGIPLAGAVERTMIYDGIWLPAIFREYVEKYGMKCEGIYRVSGIK
SKVNELKAAYDQEESTNLEEYEPNTVASLRKQYVRDLPENLLTKELMPRFEEAYGRTTET
EKVQEFQRLLKELPEGNYLLISWFIVHMDHVITKELEAKMNIQNIYIVLSPTVQISNLVL
YVFFTHVQELFGNVVLKQVTKPRRWSNVATMPTLPETQAGFKEEIRRRELLLNCLHQDLQ
GGIKDLSEEERLWEVQIILTALKRKLREAKRQGCETKIAQEIASLSKEAVSKKMNENEEV
INILLVQEKEILTKQEELLGMEQFLRRQIASEKEEIECLRAEVAEIQSQQQGLSETEEYS
SESESEDEEELQIILEDLQRNEELEIKNNHLNQAIHEESEAIIELRMQPWLLQMQPDRAK
QQAQEDEEPEWCGGAIQPPKNGNLEPVAGKKPAKPLPSRHRKEMSI
Download sequence
Identical sequences ENSGGOP00000027870 ENSGGOP00000027870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]