SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027978 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027978
Domain Number 1 Region: 59-281
Classification Level Classification E-value
Superfamily L domain-like 1.13e-40
Family Internalin LRR domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027978   Gene: ENSGGOG00000028005   Transcript: ENSGGOT00000025023
Sequence length 301
Comment pep:novel chromosome:gorGor3.1:18:7294515:7295420:1 gene:ENSGGOG00000028005 transcript:ENSGGOT00000025023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGARQSRASSKDKSPKRMLFTGRRQKFSPWDDALLSGRDPRSLLKRGMHHVSFSLVTRGM
TDIPDFLWGLSEVQKLNLSHNQLRVLPPEVGKLTRIVVLNLCGNRLKSLPREVSLLQCLK
VLFVNMNCLTEVPAELSLCRKLEVLSLSHNCLSQLPACFADLSRLRKLNLSNNFFAHIPM
CVFSLKELIFLHVGSNRLENIAESIQHLASLQIFIAEGNNIHSFPRSLCLVTSLELLNLN
NNDIQTLPSELHLLCRLVRIAWNPMDKGLHISHNPLSKPLPELVEGGLEMLFGYLKDKKH
T
Download sequence
Identical sequences G3SIN8
ENSGGOP00000027978 XP_004059218.1.27298 ENSGGOP00000027978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]