SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028171 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028171
Domain Number 1 Region: 323-506
Classification Level Classification E-value
Superfamily NTF2-like 6.78e-66
Family NTF2-like 0.000000623
Further Details:      
 
Domain Number 2 Region: 59-152
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.79e-33
Family Non-canonical RBD domain 0.00011
Further Details:      
 
Domain Number 3 Region: 504-568
Classification Level Classification E-value
Superfamily UBA-like 0.000000000765
Family TAP-C domain-like 0.0012
Further Details:      
 
Domain Number 4 Region: 158-307
Classification Level Classification E-value
Superfamily L domain-like 0.0000000578
Family mRNA export factor tap 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028171   Gene: ENSGGOG00000002085   Transcript: ENSGGOT00000024736
Sequence length 573
Comment pep:novel chromosome:gorGor3.1:X:100285141:100302686:-1 gene:ENSGGOG00000002085 transcript:ENSGGOT00000024736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSSPHQQQDGDAAMHGAHMDSPVRYTPYAISPYNRKGSFRKQDQTHVNMEREQKPPERR
MEGNMPDGTLGSWFKITVPFGIKYNEKWLLNLIQNECSVPFVPVEFHYENMHASFFVENA
SIAYALKNVSGKIWDEDNEKISIFVNPAGIRHFVHRELKSEKVEQIKLAMNQQCDVSQEA
LDLQRLPFYPGDMVNRDTKMASNPRKCMAASLDVHEENIPTLLPLNPNSNKAYQMLDIMP
KAPNINKLNFLKNKVMSAGEMDKWKGIEPGEKCADRSPVCTTFSDTSSNRNSILELFPKL
LCLDGQQSPRATLCGTEAHKRLPTCKGSFFGSEMLKNLVLQFLQQYYLIYDSGDRQGLLS
AYHDEACFSLSIPFNPEDSAPSSLCKFFKDSRNIKIIKDPYLRGELLKHTKLDIVDSLSA
LPKTQHDLSSFLVDMWYQTEWMLCFSVNGVFKEVEGQSQGSVLAFTRTFIATPGSSSSLC
IVNDKLFVRDTSHQGTQSALFTLVPTAFSSSMPAFSQEQQKMVQVFSAQSGMNYQLPQNC
LRNNQCDYVRAPHVLAWPKAKGKILEKALTQTD
Download sequence
Identical sequences ENSGGOP00000028171 ENSGGOP00000028171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]