SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028275 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028275
Domain Number 1 Region: 255-370
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.05e-33
Family UBX domain 0.00000171
Further Details:      
 
Domain Number 2 Region: 176-271
Classification Level Classification E-value
Superfamily NSFL1 (p97 ATPase) cofactor p47, SEP domain 1.26e-33
Family NSFL1 (p97 ATPase) cofactor p47, SEP domain 0.00000163
Further Details:      
 
Domain Number 3 Region: 1-46
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000323
Family TAP-C domain-like 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028275   Gene: ENSGGOG00000013539   Transcript: ENSGGOT00000022223
Sequence length 372
Comment pep:novel chromosome:gorGor3.1:20:1458564:1484089:-1 gene:ENSGGOG00000013539 transcript:ENSGGOT00000022223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAERQEALREFVAVTGAEEDRARFFLESAGWDLQIALASFYEDGGDEDIVTISQATPSS
VSRGTAPSDNRVTSFRDLIHDQDEDEEEEEGQRHRFYAGGSERSGQQIVGPPRKKSPNEL
VDDLFKGAKEHGAVAVERVTKSPGETSKPRPFAGGGYRLGAAPEEESAYVAGEKRQHSSQ
DVHVVLKLWKSGFSLDNGELRSYQDPSNAQFLESIRRGEVPAELRRLAHGGQVNLDMEDH
RDEDFVKPKGAFKAFTGEGQKLGSTAPQVLSTSSPAQQAENEAKASSSILIDESEPTTNI
QIRLADGGRLVQKFNHSHRISDIRLFIVDARPAMAATSFILMTTFPNKELADESQTLKEA
NLLNAVIVQRLT
Download sequence
Identical sequences ENSGGOP00000028275 ENSGGOP00000028275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]