SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028435 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028435
Domain Number 1 Region: 1-72
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.93e-26
Family Ubiquitin-related 0.0000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028435   Gene: ENSGGOG00000025125   Transcript: ENSGGOT00000030254
Sequence length 73
Comment pep:novel chromosome:gorGor3.1:1:60430818:60431036:1 gene:ENSGGOG00000025125 transcript:ENSGGOT00000030254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDY
EIHDGMNLELYYQ
Download sequence
Identical sequences A0A024R7B0 A0A0D9R5M0 A0A1S3GN81 A0A1U7Q2G6 A0A1U7TRJ1 A0A250XUE4 A0A286XEE7 A0A2I3LFN0 A0A2K5IS67 A0A2K5M2W2 A0A2K5PTT1 A0A2K5XZI0 A0A2K6DFG5 A0A2K6FL44 A0A2K6K121 A0A2K6N884 A0A2K6U947 A9UMW0 B4F450 F6UFU0 F7ISQ0 G1SB93 G1U9J9 G3SJZ2 G5B355 H2QFA3 H9YVU4 I3M5T2 I7KIU7 J9NU70 K9IG89 L5L4A9 M3WBB7 Q3T0Z3 Q4R5J3 Q5RCI0 Q6EGX7 Q791B0 Q9BZL1 Q9EPV8
ENSTTRP00000008081 000072179|e1p0rA1|221.1.1.211|A:21-93 001683131|e1uh6A1|221.1.1.211|A:28-100 cath|current|1p0rA00/1-73 d1p0ra_ d1uh6a1 ENSP00000351492 ENSRNOP00000027749 ENSPVAP00000008145 NP_001032799.1.59421 NP_001032799.1.76553 NP_001041706.1.87134 NP_001041706.1.92137 NP_001041708.2.100692 NP_001041708.2.4139 NP_001125281.1.23681 NP_001191045.1.46622 NP_001247979.1.72884 NP_001268879.1.91757 NP_077268.1.87134 NP_077268.1.92137 NP_079677.1.92730 XP_001493726.1.31192 XP_002761756.1.60252 XP_003275766.1.23891 XP_003275767.1.23891 XP_003461753.1.53824 XP_003499798.1.69978 XP_003735524.1.60252 XP_003809656.1.60992 XP_003809657.1.60992 XP_003981892.1.62641 XP_004060014.1.27298 XP_004060015.1.27298 XP_004398897.1.74151 XP_004442664.1.5094 XP_004595548.1.84141 XP_004632923.1.9945 XP_004667496.1.11716 XP_004782051.1.14098 XP_004865525.1.39548 XP_004865526.1.39548 XP_005336169.1.77405 XP_005346913.1.66349 XP_005346914.1.66349 XP_005346915.1.66349 XP_005405629.1.28644 XP_005587969.1.63531 XP_005587970.1.63531 XP_005682396.1.57651 XP_005682397.1.57651 XP_005910920.1.15283 XP_005966912.1.78601 XP_006044482.1.26621 XP_006044483.1.26621 XP_006044484.1.26621 XP_006044485.1.26621 XP_006161627.1.99106 XP_006206323.1.17985 XP_006242723.1.100692 XP_006510607.1.92730 XP_006740645.1.47382 XP_006905962.1.64745 XP_006905963.1.64745 XP_006928446.1.62641 XP_006928447.1.62641 XP_006987102.1.50099 XP_007079427.1.5354 XP_007079428.1.5354 XP_007104383.1.24612 XP_007460699.1.90284 XP_007460700.1.90284 XP_007624323.1.28591 XP_007993383.1.81039 XP_008056360.1.4292 XP_008056361.1.4292 XP_008156302.1.99482 XP_008529096.1.77740 XP_008591697.1.73410 XP_008831421.1.79516 XP_009251037.1.23681 XP_009432922.1.37143 XP_010347924.1.74449 XP_010632996.1.5607 XP_010826696.1.44457 XP_010826697.1.44457 XP_010952520.1.22495 XP_011378537.1.92234 XP_011378538.1.92234 XP_011378539.1.92234 XP_011734423.1.29376 XP_011734512.1.29376 XP_011810275.1.43180 XP_011810276.1.43180 XP_011849628.1.47321 XP_011849638.1.47321 XP_011949127.1.92194 XP_011949128.1.92194 XP_012496926.1.63892 XP_012496927.1.63892 XP_012646141.1.48125 XP_012785447.1.84141 XP_012885063.1.60039 XP_012889441.1.60039 XP_012889442.1.60039 XP_013842857.1.46622 XP_013842859.1.46622 XP_014338846.1.15283 XP_014338847.1.15283 XP_014701509.1.49734 XP_014943286.1.86478 XP_014943287.1.86478 XP_014943288.1.86478 XP_014978271.1.72884 XP_015320442.1.76553 XP_015344464.1.40921 XP_015391804.1.5354 XP_015453429.1.64745 XP_015861055.1.50099 XP_016009132.1.101085 XP_016063336.1.3490 XP_016287445.1.35504 XP_017194272.1.1745 XP_017355508.1.71028 XP_017355509.1.71028 XP_017498404.1.32401 XP_017735351.1.44346 XP_018874627.1.27298 XP_019283352.1.44245 XP_019600567.1.88060 XP_019788582.1.83887 XP_019819672.1.53367 XP_019819673.1.53367 XP_019819674.1.53367 XP_019819675.1.53367 XP_020021360.1.5219 XP_020763956.1.74333 XP_020851028.1.61212 XP_021063657.1.100879 XP_021508149.1.76796 XP_021561044.1.83697 XP_512356.2.37143 XP_854056.1.84170 ENSSSCP00000022340 ENSPVAP00000008145 10116.ENSRNOP00000027749 9544.ENSMMUP00000010346 9598.ENSPTRP00000017778 9600.ENSPPYP00000010695 9606.ENSP00000351492 9685.ENSFCAP00000008698 9796.ENSECAP00000006187 9913.ENSBTAP00000052140 ENSTTRP00000008081 ENSRNOP00000027749 ENSPTRP00000017778 HGL_H00000351492 ENSMMUP00000010346 ENSPTRP00000017778 ENSMUSP00000123971 ENSMUSP00000124672 ENSMUSP00000124812 ENSMUSP00000125364 ENSPANP00000002717 ENSECAP00000006187 ENSGGOP00000005870 ENSGGOP00000028435 ENSGGOP00000005870 ENSGGOP00000028435 Hs13236510___KOG3493 ENSSTOP00000004734 HR2113 mmk001005042.1 mmk001005042.2 ENSCAFP00000036708 ENSNLEP00000022787 ENSMMUP00000010346 gi|115387112|ref|NP_001041706.1| gi|13236510|ref|NP_077268.1| ENSFCAP00000008698 ENSDORP00000006086 ENSECAP00000006187 ENSDORP00000006086 ENSOCUP00000026120 ENSPPYP00000010695 ENSPPYP00000010695 ENSFCAP00000008698 ENSCJAP00000011214 ENSCJAP00000011214 ENSOCUP00000026120 ENSSSCP00000022340 ENSNLEP00000022787 ENSP00000351492 ENSP00000466910 ENSP00000468656 ENSCAFP00000036708 ENSP00000351492 ENSP00000466910 ENSP00000468656 ENSSTOP00000004734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]