SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028513 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028513
Domain Number 1 Region: 389-518
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000549
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 325-363
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000178
Family EGF-type module 0.005
Further Details:      
 
Domain Number 3 Region: 287-324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000168
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000028513
Domain Number - Region: 252-290
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0509
Family Integrin beta EGF-like domains 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028513   Gene: ENSGGOG00000028605   Transcript: ENSGGOT00000031054
Sequence length 685
Comment pep:novel chromosome:gorGor3.1:15:19418194:19427726:1 gene:ENSGGOG00000028605 transcript:ENSGGOT00000031054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAASRSASGWALLLLVALWQQRAAGSGVFQLQLQEFINERGVLASGRPCEPGCRTFFRV
CLKHFQAVVSPGPCTFGSVSTPVLGTNSFAVRDDSSGGGRNPLQLPFNFTWPGTFSLIIE
AWHAPGDDLRPEALPPDALISKIAIQGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYY
GDNCSRLCKKRNDHFGHYVCQPDGNLSCLPGWTGEYCQQPICLSGCHEQNGYCSKPAECL
CRPGWQGRLCNECIPHNGCRHGTCSTPWQCTCDEGWGGLFCDQDLNYCTHHSPCKNGATC
SNSGQRSYTCTCRPGYTGVDCELELSECDSNPCRNGGSCKDQEDGYHCLCPPGYYGLHCE
HSTLSCADSPCFNGGSCRERNQGANYACECPPNFTGSNCEKKVDRCTSNPCANGGQCLNR
GPSRMCRCRPGFTGTYCERHVSDCARNPCAHGGTCHDLENGLMCTCPAGFSGRRCEVRTS
IDACASSPCFNRATCYTDLSTDTFVCNCPYGFVGSRCEFPVGLPPSFPWVAVSLGVGLAV
LLVLLGMVAVAVRQLRLRRPDDGSREAMNNLSDFQKDNLIPAAQLKNTNQKKELEVDCGL
DKSNCGKQQNHTLDYNLAPGPLGRGTMPGKFPHSDKSLGEKAPLRLHSEKPECRISAICS
PRDSMYQSVCLISEERNECVIATEV
Download sequence
Identical sequences G3SK70
ENSGGOP00000028513 XP_004056055.1.27298 ENSGGOP00000028513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]