SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028517 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028517
Domain Number 1 Region: 294-371
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.01e-18
Family Intermediate filament protein, coiled coil region 0.0018
Further Details:      
 
Domain Number 2 Region: 68-99
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000455
Family Intermediate filament protein, coiled coil region 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028517   Gene: ENSGGOG00000022550   Transcript: ENSGGOT00000022799
Sequence length 416
Comment pep:novel chromosome:gorGor3.1:22:28974917:28976201:1 gene:ENSGGOG00000022550 transcript:ENSGGOT00000022799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSFTICSTFSTNYRSLGPAQAPSYGAGRSAVWAGTGNSGSRISMSCSTSFRGSMESRGLA
AGMGGIQNEETMQSLNDLASYLDRVRHLETKNRKLESKIWEHLEKKGPQVRDWSHYFKTI
KDQRAQSLAITVDNACIVLQINNTHLAADDFRVKYETELAMCQSVESNIHGLRKVIDDTN
ITRLQLETEIKALKEELLFMKKNHEEEVKGLQAQIASSGLTMEVDPKSQDLAKIMAAIRA
QYDELAWKNGEELDKYWSQQIEESTTVVTTQSAKAGAAEMTLAELRCTVQSLEINLDSMR
NLKASLENSLREVKACYTLQMEQLNGILLHLGSELAQTQAKGQCQAQEYEALLNIKVKLE
AEISTYCHLLEDGEDFNLGDALDSSNSMQTIPRTTTHQRVDGKVVSETNDPKVLRH
Download sequence
Identical sequences ENSGGOP00000028517 ENSGGOP00000028517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]