SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028602 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028602
Domain Number 1 Region: 334-412
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.62e-25
Family Intermediate filament protein, coiled coil region 0.001
Further Details:      
 
Domain Number 2 Region: 103-137
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000183
Family Intermediate filament protein, coiled coil region 0.0019
Further Details:      
 
Domain Number 3 Region: 216-332
Classification Level Classification E-value
Superfamily Prefoldin 0.0000146
Family Prefoldin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028602   Gene: ENSGGOG00000034856   Transcript: ENSGGOT00000040986
Sequence length 456
Comment pep:novel chromosome:gorGor3.1:5:42587423:42592223:1 gene:ENSGGOG00000034856 transcript:ENSGGOT00000040986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTTFLQTSSSTFGGGSTRGGSLLAGGGGFGGGSLCGGGGSRSISASSARFVSSGSGGGY
GGGMRVCGFGGGAGSVFGGGFGGGVGGGFGGGFGGGNGGLLSGNEKITMQNLNDRLASYL
DKVRALEEANADLEVKIHDWYQKQTPTSPECDYSQYFKTIEELRDKIMATTIDNSRVILE
IDNARLAADDFRLKYENELALRQGVEADINGLRRVLDELTLARTDLEMQIEGLNEELAYL
KKNHEEEMKEFSSQLAGQVNVEMDAAPGVDLTRVLAEMREQYEAMAEKNRRDVEAWFFSK
TEELNKEVASNTEMIQTSKTEITDLRRTMQELEIELQSQLSMKAGLENSLAETECRYATQ
LQQIQGLIGGLEAQLSELRCEMEAQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKAPGH
RGRSASSGGGGSSSNFHINVEESVDGKVVSSRKREI
Download sequence
Identical sequences ENSGGOP00000028602 ENSGGOP00000028602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]