SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028605 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028605
Domain Number 1 Region: 277-470
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.49e-59
Family BCR-homology GTPase activation domain (BH-domain) 0.0000369
Further Details:      
 
Domain Number 2 Region: 80-199
Classification Level Classification E-value
Superfamily PH domain-like 1.17e-21
Family Pleckstrin-homology domain (PH domain) 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028605   Gene: ENSGGOG00000034982   Transcript: ENSGGOT00000041099
Sequence length 475
Comment pep:novel chromosome:gorGor3.1:2b:30377112:31015302:1 gene:ENSGGOG00000034982 transcript:ENSGGOT00000041099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKSTNSDTSLETLNSTRQGTGAVQMRIKNANSHHDRLSQSKSMILTDVGKVTEPISRHR
RNHSQHILKDVIPPLEQLMVEKEGYLQKAKIADGGKKLRKNWSTSWIVLSSRKIEFYKES
KQQALSNMKTGHKPESVDLCGAHIEWAKEKSSRKNVFQITTVSGNEFLLQSDIDFIILDW
FHAIKNAIDRLPKDSSCPSRNLELFKIQRSSSTELLSHYDSDIKEQKPEHRKSLMFRLHH
SASDTSDKNRVKSRLKKFITRRPSLKTLQEKGLIKDQIFGSHLHKVCERENSTVPWFVKQ
CIEAVEKRGLDVDGIYRVSGNLATIQKLRFIVNQEEKLNLDDSQWEDIHVVTGALKMFFR
ELPEPLFPYSFFEQFVEAIKKQDNNTRIEAVKSLVQKLPPPNRDTMKVLFGHLTKIVAKA
SKNLMSTQSLGIVFGPTLLRAENETGNMAIHMVYQNQIAELMLSEYSKIFGSEED
Download sequence
Identical sequences ENSGGOP00000028605 ENSGGOP00000028605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]