SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028670 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028670
Domain Number 1 Region: 1532-1751
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.48e-33
Family Laminin G-like module 0.00043
Further Details:      
 
Domain Number 2 Region: 1814-1999
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.16e-27
Family Laminin G-like module 0.0037
Further Details:      
 
Domain Number 3 Region: 983-1190
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.8e-26
Family Laminin G-like module 0.019
Further Details:      
 
Domain Number 4 Region: 1251-1438
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.41e-23
Family Laminin G-like module 0.003
Further Details:      
 
Domain Number 5 Region: 40-58,743-903
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.07e-20
Family Laminin G-like module 0.025
Further Details:      
 
Domain Number 6 Region: 4-92,954-997
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000204
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 7 Region: 1190-1228
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000109
Family EGF-type module 0.014
Further Details:      
 
Domain Number 8 Region: 1753-1790
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000495
Family EGF-type module 0.04
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000028670
Domain Number - Region: 1467-1509
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000698
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028670   Gene: ENSGGOG00000034946   Transcript: ENSGGOT00000040990
Sequence length 2021
Comment pep:novel chromosome:gorGor3.1:6:63244406:64167222:-1 gene:ENSGGOG00000034946 transcript:ENSGGOT00000040990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFLRCLPGFSGQFCEININECSSSPCLHGADCEDHINAYVCKCQAGWSGHHCEKELECIP
NSCVHELCMENEPGSTCLCTPGFMTCSIGLLCGDEIRRITCLTPIFQRTDPISTQTYTVP
PSETLVSSFPSIKATRIPAIMDTYPVDQGPKQTGIVKHDILPTTGLATLRISTPLENYLL
EELIVTRELSAKHSLLSSADVSSSRFLNFGIHDPAQIVQDKTSVSHMPIRTSAATLGFFF
PDRRARTPFIMSSLMSDFIFPTQSLLFENYQTVASSATPTTSVIRSIPGADIELNRQSLL
SRGFLLTAASISATPVVSRGAQEDIEEYSADSLISRREHWRLLSPSMSPIFPAKIIISKQ
VTILNSSALHRFGTKAFNPSEYQAITEASSNQRLTNIKSQAADSLRELSQTCATCSMTEI
KSSREFSDQILHSKQFHFYETFCMNSAILASWYALMGAQTITSGHSLSSATEITPSVAFT
EVPSLFPSKKSAKRTILSSSLEESITLSSNLDVNLCLDKTCLSIVPSQTISSDLMNSDLT
SKMTTDELSVSENILKLLKMRQYGITMGPTEVLNQESLLDMEKSKGSHTLFKLHPSDSSL
DFELNLQIYPDVTLKTYSEITHANDVKNNLPPLTGSVPDFSEVTTNVAFYTVSATPALSI
QTSSSMSVIRPDWPHFTDYMTSLKKEVKTSSEWSKWELQPSVQYQEFPTASRHLPFTRSL
TLSSLESILAPQRLMISDFSCVRYYGDSYLEFQNVVLNPQNNISLEFQTFSSYGLLLYVK
QDSNLVDGFFIQLFIENGTLKYHFYCPGEAKFKSINTTVRVDNGQKYTLLIRQELDPCKA
ELTILGRNTQTCESINHVLRKPLPKSGSVFIGGFPDLHGKIQMPVPVKNFTGCIEVIEIN
NWRSFIPSKAVKNYHINNCRSQGFMLSPTASFVDASDVTQGVDTMWTSVSPSVAAPSVCQ
QDVCHNGGTCHPIFLSSGIVSFQCDCPLHFTGRFCEKDAGLFFPSFNGNSYLELPFLKFV
LEKEHNRTVTIYLTIKTNSLNGTILYSNGNNFGKQFLHLFLVEGRPSVKYGCGNSQNILT
VSANYSINTNAFTPITIRYTTPVGSPGVVCMIEMTADGKPPVQKKDTEISQASQAYFESI
FLGHIPANVQIHKKAGPVYGFRGCILDLQVNNKEFFIIDEARHGKNIENCHVPWCAHHLC
RNNGTCISDNENLFCECPRLYSGKLCQFASCENNPCGNGATCVPKSGTDIVCLCPYGRSG
PLCTDAINITQPRFSGTDAFGYTSFLAYSRISDISFHYEFHLKFQLANNHSALQNNLIFF
TGQKGHGLNGDDFLAVGLLNGSVVYSYNLGSGIASIRSEPLNLSLGVHTVHLGKFFQEGW
LKVDDHKNKSIIAPGRLVGLNVFSQFYVGGYSEYTPDLLPNGADFKNGFQGCIFTLQVRT
EKDGHFRGLGNPEGHPNAGRSVGQCHASPCSLMKCGNGGTCIESGTSVYCNCTTGWKGSF
CTETVSTCDPEHDPPHHCSRGATCISLPHGYTCFCPLGTTGIYCEQALILIVILEKPKPA
EWKVKKEALSISDPSFRSNELSWMSFASFHVRKKTHIQLQFQPLAADGILFYAAQHLKAQ
SGDFLCISLVNSSVQLRYNLGDRTIILETLQKVTINGSTWHIIKAGRVGAEGYLDLDGIN
VTEKASTKMSSLDTNTDFYIGGVSSLNLVNPMAIENEPVGFQGCIRQVIINNQELQLTEF
GAKGGSNVGDCDGTACGYNTCRNGGECTANGTTFSCRCLPDWAGNTCNQSVSCLNNLCLH
QSLCIPDQSFSYSCLCTLGWVGRYCENKTSFSTAKFMGNSYIKYIDPNYRMRNLQFTTIS
LNFSTTKTEGLIVWMGIAQNEENDFLAIGLHNQTLKIAVNLGERISVPMSYNNGTFCCNK
WHHVVVIQNQTLIKAYINNSLILSEDIDPHKNFVALNYDGICYLGGFEYGRKVNIVTQEI
FKTNFVGKIKDVVFFQDPKNIELIKLEGYNVYDGDEQNEVT
Download sequence
Identical sequences ENSGGOP00000028670 ENSGGOP00000028670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]