SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028731 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028731
Domain Number 1 Region: 347-421,464-676
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.45e-80
Family Protein kinases, catalytic subunit 0.00000000248
Further Details:      
 
Domain Number 2 Region: 54-258
Classification Level Classification E-value
Superfamily Fibronectin type III 8.11e-35
Family Fibronectin type III 0.00016
Further Details:      
 
Domain Number 3 Region: 682-754
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.95e-20
Family SAM (sterile alpha motif) domain 0.00034
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000028731
Domain Number - Region: 2-46,92-107
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0034
Family Growth factor receptor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028731   Gene: ENSGGOG00000034920   Transcript: ENSGGOT00000041098
Sequence length 759
Comment pep:novel chromosome:gorGor3.1:3:96233757:96748509:1 gene:ENSGGOG00000034920 transcript:ENSGGOT00000041098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ACRPGFYKAFAGNTKCSKCPPHSLTYMEATSVCQCEKGYFRAEKDPPSMACTRPPSAPRN
VVFNINETALILEWSPPSDTGGRKDLTYSVICKKCGLDTSQCEDCGGGLRFIPRHTGLIN
NSVIVLDFVSHVNYTFEIEAMNGVSELSFSPKPFTAVTVTTDQDAPSLIGVVRKDWASQN
SIALSWQAPAFSNGAILDYEIKYYEKEHEQLTYSSTRSKAPSVIITGLKPATKYVFHIRV
RTATGYSGYSQKFEFETGDETSDMAAEQGQILVIATAAVGGFTLLVILTLFFLITGRCQW
YIKAKMKSEEKRRNHLQNGHLRFPGIKTYIDPDTYEDPSLAVHEFAKEIDPSRIRIERVI
GAGEFGEVCSGRLKTPGKREIPVAIKTLKGGHMDRQRRDFLREASIMGQFDHPNIIRLEG
VVTKRSFPAIGVEAFCPSFLRAGFLNSIQAPHPVPGGGSLPPRIPAGRPVMIVVEYMENG
SLDSFLRKHDGHFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILVNSNLVCKVSDF
GLSRVLEDDPEAAYTTTGGKIPIRWTAPEAIAYRKFSSASDAWSYGIVMWEVMSYGERPY
WEMSNQDVILSIEEGYRLPAPMGCPASLHQLMLHCWQKERNHRPKFTDIVSFLDKLIRNP
SALHTLVEDILVMPESPGEVPEYPLFVTVGDWLDSIKMGQYKNNFVAAGFTTFDLISRMS
IDDIRRIGVILIGHQRRIVSSIQTLRLHMMHIQEKGFHV
Download sequence
Identical sequences ENSGGOP00000028731 ENSGGOP00000028731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]