SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000227 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000227
Domain Number 1 Region: 260-497
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-55
Family Voltage-gated potassium channels 0.001
Further Details:      
 
Domain Number 2 Region: 99-210
Classification Level Classification E-value
Superfamily POZ domain 4.19e-26
Family Tetramerization domain of potassium channels 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000227   Gene: ENSGGOG00000000231   Transcript: ENSGGOT00000000232
Sequence length 545
Comment pep:novel chromosome:gorGor3.1:9:2693960:2705667:1 gene:ENSGGOG00000000231 transcript:ENSGGOT00000000232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKQSERRRSWSYKPWNTTENEGSQHRRSICSLGARSGSQASIQGWTEGNYNYYIEEDED
GEEEDQWKDDLAEEDQQAEEVTTAKPEGPSDPPALLSTLNVNVGGHSYQLDYCELASFPK
TRLGRLATSTSRSRQLSLCDDYEEQTDEYFFDRDPAVFQLVYNFYLSGVLLVLDELCPRC
FLEELGYWGVRLKYTPRCCRICFEERRDELSEQLKIQHELRAQAQVEEAEELFRDMRFYG
PQRRRLWNLMEKPFSSVAAKAIGVASSIFVLVSVVALALNTVEEMQQHSEQDEGGPDLRP
ILEHVEMLCIGFFTLEYLLRLASTPDLRRFARSALNLVDLVAILPLYLQLLLECFTGEDH
QRGQTVGSVGKVGQVLRVMRLMRIFRILKLARHSTGLRAFGFTLRQCYQQVGCLLLFIAM
GIFTFSAAVYSVEHDVPSTNFTTIPHSWWWAAVSISTVGYGDMYPETHLGRFFAFLCIAF
GIILNGMPISILYNKFSDYYSKLKAYEYTAIRRERGEVNFMQRARKKIAECLVGSNPQPT
PRQEN
Download sequence
Identical sequences G3QDB6
ENSGGOP00000000227 ENSGGOP00000000227 XP_004047802.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]