SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000425 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000425
Domain Number 1 Region: 41-242
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.14e-28
Family Laminin G-like module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000425   Gene: ENSGGOG00000000424   Transcript: ENSGGOT00000000434
Sequence length 1707
Comment pep:novel chromosome:gorGor3.1:1:88052902:88486820:-1 gene:ENSGGOG00000000424 transcript:ENSGGOT00000000434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLRAHRTRRGKVSPTAKTKSLLQFIVLCVAGVVIHAQEQGIDILHQLGLGGKDVRHSSS
ATAVPSASTPLPQGVHLTESGVIFKNDAYIETPFVNILPVNLGQPFTILTGLQSHRVNNA
FLFSIRNKNRLQLGVQLLPKKLVVHIRGKQPAVFNYSVHDEQWHSFAITIRNQSVSMFVE
CGKKYFSTETIPEVQTFDSNSVFTLGSMNNNSVHFEGIVCQLDIIPSAEASADYCRYVKQ
QCRQADKYQPETSLPCTTLIPTKIPEHSAPPKRFAEKVLSEDTFTEGKSIPNIIKNDSET
LYKRQEHQISRSQLSSLQSGNVSAVDLTNHGIQAKEMITEEDTQTNFSLSVIPHRISEAR
MNTKEKFSSLLNMSDNITQHDDRVTGLSLFKKMPSILPQIKQDTITNLKKAITANLHTNE
LMEMQPILNTSLHRVTNEPSVDNHLDLRKEGEFYPDATYPIENSYETELYDYYYYEDLNT
MLEMEYLRGPKGDTGPPGPPGPAGIPGPSGKRGPRGIPGPHGNPGLPGLPGPKGPKGDPG
FSPGQAVPGEKGDQGLSGLMGPPGMQGNKGLKGHPGLPGLPGEQGIPGFAGNIGSPGYPG
RQGLAGPEGNPGPKGARGFIGSPGEVGQLGPEGERVSPFPSNSISKQGFPGDFGDRGPAG
LDGSPGLVGGTGPPGFPGLRGSVGPVGPIGPAGIPGPMGLSGNKGLPGIKGDKGEQGTAG
ELGEPGYPGDKGAVGLPGPPGMRGKPGPSGQTGDPGLQGQSGPPGPEGFPGDIGIPGQNG
PEGPKGLLGNRGPPGPPGLKGTQGEEGPIGPFGELGPRGKPGQKGYAGEPGPEGLKGEVG
DQGNIGKIGETGPVGLPGEVGMTGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGVPGPIG
PLGLPGHVGARGPPGSQGPKGQRGPRGPDGLLGEQGIQGAKGEKGDQGKRGPHGLIGKTG
NPGERGFQGKPGLQGLPGSTGDRGLPGEPGLRGLQGDVGPPGEMGMEGPPGTEGESGLQG
EPGAKGDVGPAGSVGGTGEPGLRGEPGAPGEEGLQGKDGLKGVPGGRGLPGEDGEKGEMG
LPGIIGPLGRSGQTGLPVSTAGFTFKYCHPQGDKGQIGPTGEVGSRGPPGKTGKSGPKGA
RGTRGAVGHLGLMGPDGEPGIPGYRGHQGQPGPSGLPGPKGEKGYPGEDSTVLGLPGPRG
EPGPVGEQGERGEPGAEGYKGHVGVPGLRGATGQQGPPGEPGDQGEQGLKGERGSEGNKG
KKGAPGPSGKPGIPGLQGLLGPKGIQGYHGADGISGNPGKVGPPGKQGLPGIRGGPGRTG
LAGAPGPPGVKGSSGLPGSPGIQGPKGEQGLPGQPGIQGKRGHRGAQGDQGPCGEPGLKG
QPGEYGVQGLTGFQGFPGPKGPEGDAGIVGISGPKGPVGHRGNTGPLGREGIIGPTGRTG
PRGEKGFRGETGPQGPRGQPGPPGPPGAPGPRKQMDINAAIQALIESNTALQMESYQNTE
VTLIDHSEEIFKTLNYLSNLLHSIKNPLGTRDNPARICKDLLNCEQKVSDGKYWIDPNLG
CPSDAIEVFCNFSAGGQTCLPPVSVTKLEFGVGKVQMNFLHLLSSEATHIITIHCLNAPR
WTSTQTSGPGLPIGFKGWNGQIFKVNTLLEPKVLSDDCKIQDGSWHKATFLFHTQEPNQL
PVIEVQKLPHLKTERKYYIDSSSVCFL
Download sequence
Identical sequences ENSGGOP00000000425 ENSGGOP00000000425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]