SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000518 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000518
Domain Number 1 Region: 527-563,638-712
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000173
Family Anti-sigma factor antagonist SpoIIaa 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000518   Gene: ENSGGOG00000000525   Transcript: ENSGGOT00000000531
Sequence length 747
Comment pep:novel chromosome:gorGor3.1:7:100915639:100963277:-1 gene:ENSGGOG00000000525 transcript:ENSGGOT00000000531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHAEENEILAATQRYYVERPIFSHPVLQERLHTKDKVPDSIADKLKQAFTCTPKKIRNI
IYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPIFGLYSSFYPV
IMYCFLGTSRHISIGPFAVISLMIGGVAVRLVPDDIVIPGGVNATNGTEARDALRVKVAM
SVTLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGI
FSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKEFNERFKEKLPAPIPLEFFAVVMG
TGISAGFNLKESYNVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGFSVTISMAKT
LANKHGYQVDGNQMGKELIALGLCNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLA
SLMILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFV
SSLFLGLDYGLITAVIIALLTVIYRTQSETYKILGNLPSISNLSQMVLYKEVKEIPGIKI
FQINAPIYYANSDLYSNALKRKTGVNPAVIIGARRKAMRKYAKEVGNANMANATVVKADA
EVDGEDATKPEEKDGEVKYPPIVIKSTFPEEMQRFMPPGDNVHTVILDFTQVNFIDSVGV
KTLAGIVKEYGDVGIYVYLAGCSAQVVNDLTRNRFFENPALWELLFHSIHDAVLGSQLRE
ALAEQEASAPPSQEDLEPNATPATPEA
Download sequence
Identical sequences ENSGGOP00000000518 ENSGGOP00000018072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]