SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000638 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000638
Domain Number 1 Region: 34-183
Classification Level Classification E-value
Superfamily L domain-like 1.56e-30
Family Ngr ectodomain-like 0.043
Further Details:      
 
Domain Number 2 Region: 537-597
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000108
Family SAM (sterile alpha motif) domain 0.0059
Further Details:      
 
Domain Number 3 Region: 633-682
Classification Level Classification E-value
Superfamily RING/U-box 0.00000261
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000000638
Domain Number - Region: 295-358
Classification Level Classification E-value
Superfamily Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain 0.0222
Family Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000638   Gene: ENSGGOG00000000649   Transcript: ENSGGOT00000000654
Sequence length 689
Comment pep:novel chromosome:gorGor3.1:9:110977009:111025558:1 gene:ENSGGOG00000000649 transcript:ENSGGOT00000000654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLFFRKRKPSEEARKRLEYQMCLAKEAGADDILDISKCELSEIPFGAFATCKVLQKKVL
IVHTNHLTSLLPKSCSLLSLATIKVLDLHDNQLTALPDDLGQLTALQVLNVERNQLIQLP
RSIGNLTQLQTLNVKDNKLKELPDTLGELRSLRTLNISGNEIQRLPQMLAHVRTLEMLSL
DASAMVYPPREVCGAGTAAILQFLCKESGLEYYPPSQYLLPVLEQDGTENSRDSPDGPTD
RFSREELEWQNRFSDYEKRKEQKMLEKLEFERRLELGQREHAQLLQQSSSQKDEILQTVK
EEQSRLEQGLSEHQRHLDAERQRLQEQLKQTEQNISSRIQKLLQDNQRQKKSSEILKSLE
NERIRMEQLMSITQEETENLRRRDVAMAEMDERFQQILSWQQMDQNKAISQILQESAMQK
AAFEALQVKKDLMHRQIRSQIKLIETELLQLTQLELKRKSLDTESLQEMISEQRWALSSL
LQQLLKEKQQREEELREILTELEAKSETRQENYWLIQYQRLLNQKPLSLKLQEEGMERQL
VALLEELSAEHYLPIFAHHRLSLDLLSQMSPGDLAKVGVSEAGLQHEILRRVQELLDAAR
IQPELKPPMGEVVTPTAPREPPESVRPSAPPAELEVQASECVVCLEREAQMIFLNCGHVC
CCQQCCQPLRTCPLCRQDIAQRLRIYHSS
Download sequence
Identical sequences ENSGGOP00000000638 ENSGGOP00000000638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]