SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000713 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000713
Domain Number 1 Region: 342-585
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.28e-21
Family Nucleotide and nucleoside kinases 0.0079
Further Details:      
 
Domain Number 2 Region: 102-290
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.00000000000526
Family Tyrosine-dependent oxidoreductases 0.03
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000000713
Domain Number - Region: 656-691
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0214
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000713   Gene: ENSGGOG00000000725   Transcript: ENSGGOT00000000729
Sequence length 697
Comment pep:novel chromosome:gorGor3.1:14:78278327:78374019:1 gene:ENSGGOG00000000725 transcript:ENSGGOT00000000729 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEEEETAAPTEKVIRTQRVFINLLDSYSSGNIGKFLSNCVVGASLEEITEEEEEEDENK
SAMLEASSTKVKEGTFQIVGTLSKPDSPRPDFAMETYSAISREDLLMRLLECDVIIYNIT
ESSQQTEEAIWAVSALSEEVSHFEKRKLFILLSTVMTWARSKALDPEDSEVPFTEEDYRR
RKSHPNFLDHINAEKMVLKFGKKARKFATYVVAAGLQYGAEGGMLHTFFKMAWLGEIPAL
PVFGDGTNVIPTIHVLDLAGVIQNVIDHVPKPHYLVAVDESVHTLEDIVKQDCLDHLLVN
LRMEALFVKENFNIRWAAQTGFVENINTILKEYKQSRGLMPIKICILGPPAVGKSSIAEE
LAKYYKLHHIQLKDVISEAIAKLEAIVAPNDVGEGDEEVEEEEEEENVEDAQELLDGIKE
SMEQNAGQLDDQYIIRFMKEKLKSMPCRNQGYILDGFPKTYDQAKDLFNQEDEEEEDEVR
GRMFPFDKLIIPEFVCALDASDEFLKERVINLPESIVAGTHYSQDRFLRALSNYRDINID
DETVFNYFDELEIHPIHIDVGKLEDAQNRLAIKQLIKEIGEPRNYGLTDEEKAEEERKAA
EERLAREAAEEAEREHQEAVEMAEKIARWEEWNKRLEEVKREERELLEAQSIPLRNYLMT
YVMPTLIQGLNECCNVRPEDPVDFLAEYLFKNNPEAQ
Download sequence
Identical sequences ENSGGOP00000000713 ENSGGOP00000000713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]