SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000730 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000730
Domain Number 1 Region: 39-322
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.04e-64
Family Protein kinases, catalytic subunit 0.00026
Further Details:      
 
Domain Number 2 Region: 1154-1310
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.96e-43
Family Chaperone J-domain 0.000000587
Further Details:      
 
Domain Number 3 Region: 407-561
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.2e-28
Family Dual specificity phosphatase-like 0.00012
Further Details:      
 
Domain Number 4 Region: 571-708
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.23e-18
Family PLC-like (P variant) 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000730   Gene: ENSGGOG00000000740   Transcript: ENSGGOT00000000746
Sequence length 1311
Comment pep:novel chromosome:gorGor3.1:4:853842:941669:-1 gene:ENSGGOG00000000740 transcript:ENSGGOT00000000746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLLQSALDFLAGPGSLGGASGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDV
GSGREYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQAEFL
LLTELCKGQLVEFLKKMESRGPLSCDTVLKIFYQTCRAVQHMHRQKPPIIHRDLKVENLL
LSNQGTIKLCDFGSATTISHYPDYSWSAQRRALVEEEITRNTTPMYRTPEIIDLYSNFPI
GEKQDIWALGCILYLLCFRQHPFEDGAKLRIVNGKYSIPPHDTQYTVFHSLIRAMLQVNP
EERLSIAEVVHQLQEIAAARNVNPKSPITELLEQNGGYGSATLSRGPPPPVGPAGSGYSG
GLALAEYDQPYGGFLDILRGGTERLFTNLKDTSSKVIQSVANYAKGDLDISYITSRIAVM
SFPAEGVESALKNNIEDVRLFLDSKHPGHYAVYNLSPRTYRPSRFHNRVSECGWAARRAP
HLHTLYNICRNMHAWLRQDHKNVCVVHCMDGRAASAVAVCSFLCFCRLFSTAEAAVYMFS
MKRCPPGIWPSHKRYIEYMCDMVAEEPITPHSKPILVRAVVMTPVPLFSKQRSGCRPFCE
VYVGDERVASTSQEYDKMRDFKIEDGKAVIPLGVTVQGDVLIVIYHARSTLGGRLQAKMA
SMKMFQIQFHTGFVPRNATTVKFAKYDLDACDIQEKYPDLFQVNLEVEVEPRDRPSREAP
PWENSSMRGLNPKILFSSREEQQDILSKFGKPELPRQPGSTAQYDAGAGSPEAEPTDSDS
PPSSSADASRFLHTLDWQEEKEAETGAENASPKESESALMEDRDESEVSDEGGSPISSEG
QEPRADPEPPGLAAGLVQQDLVFEVETPAVLPEPVPQEDGVDLLGLHSEVGAGPAVPPQA
RRAPSSNTDLLSCLLGPPEAASQGSPEDLLSEAPLLLASPAPPLSVQSTPRGGPPAAADP
FGPLLPSSGNDSQPCSNPDLFGEFLSSDSVTGPPSLPSAHSAPPPSCSADFLHLGDLPGE
PSKMTASSSNPDLLGGWVAWTESAASAVAPTPATEGLLFSPGGQPAPCGSQASWTKSQNP
DPFADLGDLSSGLQGSPAGFPPGGFIPKTATTPKGSSSWQTSRPPAQGAPWPPQAKPPPK
ACTQPRPNYASNLSVIGAREERGVRAPSFAQKPKVSENDFEDLLSNQGFSSRSDKKGPKT
IAEMRKQDLAKDTDPLKLKLLDWIEGKERNIRALLSTLHTVLWDGESRWTPVGMADLVAP
EQVKKHYRRAVLAVHPDKAAGQPYEQHAKMIFMELNDAWSEFENQGSRPLF
Download sequence
Identical sequences ENSGGOP00000000730 ENSGGOP00000000730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]