SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000995 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000995
Domain Number 1 Region: 509-699
Classification Level Classification E-value
Superfamily Sec7 domain 3.14e-66
Family Sec7 domain 0.00000455
Further Details:      
 
Domain Number 2 Region: 731-855
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000154
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000995   Gene: ENSGGOG00000001008   Transcript: ENSGGOT00000001017
Sequence length 1158
Comment pep:novel chromosome:gorGor3.1:3:13260119:13452505:-1 gene:ENSGGOG00000001008 transcript:ENSGGOT00000001017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACRRRYFVEGEAPSSETGTSLDSPSAYPQGPLVPGSSLSPDHYEHTSVGAYGLYSGPPG
QQQRTRRPKLQHSTSILRKQAEEEAIKRSRSLSESYELSSDLQDKQVEMLERKYGGRLVT
RHAARTIQTAFRQYQMNKNFERLRSSMSENRMSRRIVLSNMRMQFSFEGPEKVHSSYFEG
KQVSVTNDGSQLGALVPPECGDLSEPTTLKSPAPSSDFADAITELEDAFSRQVKSLAESI
DDALNCRSLHTEEAPALDAARARDTEPQTALHSMDHRKLDEMTASYSDVTLYIDEEELSP
PLPLSQAGDRPSSTESDLRLRAGGAAPDYWALAHKEDKADTDTSCRSTPSLERQEQRLRV
EHLPLLTIEPPSDSSVDLSDRSERGSLKRQSAYERSLGGQQGSPKHGPHSGAPKSLPREE
PELRPRPPRPLDSHLAINGSANRQSKSESDYSDGDNDSINSTSNSNDTINCSSESSSRDS
LREQTLSKQTYHKEARNSWDSPAFSNDVIRKRHYRIGLNLFNKKPEKGVQYLIERGFVPD
TPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSTMELDEALRKFQAH
IRVQGEAQKVERLIEAFSQRYCICNPGVVRQFRNPDTIFILAFAIILLNTDMYSPNVKPE
RKMKLEDFIKNLRGVDDGEDIPREMLIGIYERIRKRELKTNEDHVSQVQKVEKLIVGKKP
IGSLHPGLGCVLSLPHRRLVCYCRLFEVPDPNKPQKLGLHQREIFLFNDLLVVTKIFQKK
KNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSSVPGADIKVLINFNAPNPQDRKKFT
DDLRESIAEVQEMEKHRIESELEKQKGVVRPSMSQCSSLKKESGNGTLSRACLDDSYASG
EGLKRSALSSSLRDLSEAGKSLANHLASPEFPFGSIISSPHMRRRATSTRECPSRPHQTM
PNSSSLLGSLFGSKRGKPPPQAHLPSAPAATPPPTGDPASLAALCGWPPPGAPRGAAAGP
RARASHPVLPHAAEPSPVPPSPPPPPTPAHPARTPVPPRPPWGPPSLWGPRPRPPAAALG
PRGAHSAPPWAAPCPAAPHQQQGQTQRHQHNCVDSLGRGPRLPETAAHHTGHARWSPATH
QTQGTSVAISPLCASQPN
Download sequence
Identical sequences ENSGGOP00000000995 ENSGGOP00000000995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]