SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001016 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001016
Domain Number 1 Region: 330-440
Classification Level Classification E-value
Superfamily SH2 domain 2.15e-20
Family SH2 domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001016   Gene: ENSGGOG00000001032   Transcript: ENSGGOT00000001039
Sequence length 456
Comment pep:novel chromosome:gorGor3.1:10:109528340:109583357:-1 gene:ENSGGOG00000001032 transcript:ENSGGOT00000001039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKLNKITVPASQKLRQLQKMVHDIKNNEGGIMNKIKKLKVKAPPSVPRRDYASESPADE
EEQWSDDFDSDYENPDEHSDSEMYVMPAEENADDSYEPPPVEQETRPVHPALPFARGEYI
DNRSSQRHSPPFSKTLPSKPSWPSEKARLTSTLPALTALQKPQVPPKPKGLLEDEADYVV
PVEDNDENYIHPTESSSPPPEKAPIVNRSTKPNSSTPASPPGTASGRNSGAWETKSPSPA
APSPLPRAGKKPTTPLKTTPVASQQNASSVCEEKPIPAERHRGSSHRQEAVQSPVFPPAQ
KQIHQKPIPLPRFTEGGNPTVDGPLPSFSSNSTISEQEAGVLCKPWYAGACDRKSAEEAL
HRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRFIEATKQYALGRKKNGEEYFG
SVAEIIKNHQHSPLVLIDSQNNTKDSTRLKYAVKVS
Download sequence
Identical sequences G3SCW8
ENSGGOP00000025946 ENSGGOP00000001016 XP_004049898.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]