SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001259 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001259
Domain Number 1 Region: 58-166
Classification Level Classification E-value
Superfamily Cystatin/monellin 6.59e-33
Family Cystatins 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001259   Gene: ENSGGOG00000001275   Transcript: ENSGGOT00000001283
Sequence length 167
Comment pep:novel chromosome:gorGor3.1:20:25576437:25587309:1 gene:ENSGGOG00000001275 transcript:ENSGGOT00000001283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPEKALHSHPQLPRTVPTRAAMRAAGTLLAFCCLVLSTTGGPSPDTCSQDLNSGVKPGF
PKTIKTNDPGVLQAARYSVEKFNNCTNDKFLFRESRITRALVQIVKGLKYMLEVEIGRTT
CKKNQHPRLDDCDFQTNHTLKQTLSCYSEVWVVPWLQHFEVPVLRCH
Download sequence
Identical sequences XP_004061965.1.27298 ENSGGOP00000001259 ENSGGOP00000001259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]