SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001276 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001276
Domain Number 1 Region: 10-137
Classification Level Classification E-value
Superfamily Hormone receptor domain 1.44e-30
Family Hormone receptor domain 0.00035
Further Details:      
 
Domain Number 2 Region: 123-395
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000000467
Family Rhodopsin-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001276   Gene: ENSGGOG00000001291   Transcript: ENSGGOT00000001301
Sequence length 423
Comment pep:novel chromosome:gorGor3.1:7:31351962:31367472:1 gene:ENSGGOG00000001291 transcript:ENSGGOT00000001301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRRMWGAHVFCVLSPLPTVLGHMHPECDFITQLREDESACLQAAEEMPNTTLGCPRTWD
GLLCWPTAGSGEWVTLPCPDFFSHFSSESGAVKRDCTITGWSEPFPPYPVACPVPLELLA
EEESYFSTVKIIYTMGHSISIVALFVAITILVALRRLHCPRNYVHTQLFATFILKAGAVF
LKDAALFHSDDTDHCSFSTVLCKVSVAASHFATMTNFSWLLAEAIYLTCLLASTSPSSRR
AFWWLVLAGWGLPVLFTGTWVSCKLAFEDIACWDLDDTSPYWWIIKGPIVLSVGVNFGLF
LNIIRILVRKLEPAQGSLHTQSQYWRLSKSTLFLIPLFGIHYIIFNFLPDNAGLGIRLPL
ELGLGSFQGFIVAILYCFLNQEVRTEISRKWHGHDPELLPAWRTRAKWTTPSRSAAKVLT
SMC
Download sequence
Identical sequences A0A2I2ZHN5
ENSGGOP00000001276 ENSGGOP00000001276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]