SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001610 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001610
Domain Number 1 Region: 513-761
Classification Level Classification E-value
Superfamily Ras GEF 1.16e-36
Family Ras GEF 0.011
Further Details:      
 
Domain Number 2 Region: 140-257
Classification Level Classification E-value
Superfamily SH2 domain 4.85e-25
Family SH2 domain 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001610   Gene: ENSGGOG00000001635   Transcript: ENSGGOT00000001645
Sequence length 825
Comment pep:novel chromosome:gorGor3.1:1:96078219:96205155:-1 gene:ENSGGOG00000001635 transcript:ENSGGOT00000001645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGKFASLPRNMPVNHQFPLASSMDLLSSRAPLAEHRPDAYQDVSIHGTLPRKKKGPPP
IRSCDDFSHMGTLPHSKSPRQNSPVTQDGIQESPWQDRHGETFTFRDPHLLDPTVEYVKF
SKERHIMDRTPEKLKKELEEELLLSSEDLRSHAWYHGRIPRQVSENLVQRDGDFLVRDSL
SSPGNFVLTCQWKNLAQHFKINRTVLRLSEAYSRVQYQFEMESFDSIPGLVRCYVGNRRP
ISQQSGAIIFQPINRTVPLRCLEERYGTSPGQAREGSLTEGRPDVAKRLSLTMGGVQARE
QNLPRGNLLRNKEKSGSQPACLDHMQDRRALSLKAHQSESYLPIGCKLPLQSSGVDTSPC
PNSPVFRTGSEPALSPAVVRRVSSDARAGEALRGSDSQLCPKPPPKPCKVPFLKVPSSPS
AWLNSEANYCELNPAFATGCGRGAKLPSCAQGSHTELLTAKQNGAPGPRNSGVNYLILDD
DDRERPWEPAAAQMEKGQWDKGEFVTPLLETVSSFRPNEFESKFLPPENKPLETAMLKRA
KELFTNNDPKVIAQHVLSMDCRVARILEVSEEMRRNMGVSSGLELITLPHGRQLRLDIIE
RHNTMAIGIAVDILGCTGTLEDRAATLSKIIQVAVELKDSMGDLYSFSALMKALEMPQIT
RLEKTWTALRHQYTQTAILYEKQLKPFSKLLHEGRESTCVPPNNVSVPLLMPLVTLMERQ
AVTFEGTDMWEKNDQSCEIMLNHLATARFMAEAADSYRMNAERILAGFQPDEEMNEICKT
EFQMRLLWGSKGAQVNQTERYEKFNQILTALSRKLEPPPVKQAEL
Download sequence
Identical sequences G3QGZ4
ENSGGOP00000001610 XP_004026200.1.27298 ENSGGOP00000001610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]