SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001678 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001678
Domain Number 1 Region: 106-182
Classification Level Classification E-value
Superfamily EF-hand 4.42e-18
Family Calmodulin-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001678   Gene: ENSGGOG00000001703   Transcript: ENSGGOT00000001715
Sequence length 265
Comment pep:novel chromosome:gorGor3.1:2b:121856295:121909000:1 gene:ENSGGOG00000001703 transcript:ENSGGOT00000001715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CEERAARQLPAPRPASPRSRVLRSAAMASEELACKLERRLRREEAEESGPQLAPLGAPAP
EPKPEPEPPARAPTASADAELSAQLSRRLDINEGAARPRRCRVFNPYTEFPEFSRRLIKD
LESMFKLYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKSMIKEVDEDFDGKLSFREFLLI
FHKAAAGELQEDSGLMALAKLSEIDVALEGVKGAKNFFEAKVQALSLASKFEAELKAEQD
ERKREEEERRLRQAAFQKLKANFNT
Download sequence
Identical sequences ENSGGOP00000001678 ENSGGOP00000001678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]