SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001867 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001867
Domain Number 1 Region: 102-306
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-50
Family DBL homology domain (DH-domain) 0.000000297
Further Details:      
 
Domain Number 2 Region: 293-455
Classification Level Classification E-value
Superfamily PH domain-like 1.41e-32
Family Pleckstrin-homology domain (PH domain) 0.0047
Further Details:      
 
Domain Number 3 Region: 582-683,732-758
Classification Level Classification E-value
Superfamily SH2 domain 2.59e-27
Family SH2 domain 0.00051
Further Details:      
 
Domain Number 4 Region: 504-613
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000021
Family SH3-domain 0.0016
Further Details:      
 
Domain Number 5 Region: 700-747
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000296
Family SH3-domain 0.0021
Further Details:      
 
Domain Number 6 Region: 22-140
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000207
Family Calponin-homology domain, CH-domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001867   Gene: ENSGGOG00000001895   Transcript: ENSGGOT00000001908
Sequence length 762
Comment pep:novel chromosome:gorGor3.1:1:110414466:110632793:-1 gene:ENSGGOG00000001895 transcript:ENSGGOT00000001908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FWKKKSYIFRTTYLISIFLFSQVIETLSRLSRTPIALATGIRPFPTEESINDEDIYKGLP
DLIDETLVEDEEDLYDCVYGEDEGGEVYEDLMKAEEAHQPKCPENDIRSCCLAEIKQTEE
KYTETLESIEKYFMAPLKRFLTAAEFDSVFINIPELVKLHRNLMQEIHDSIVNKNDQNLY
QVFINYKERLVIYGQYCSGVESAISSLDYISKTKEDVKLKLEECSKRANNGKFTLRDLLV
VPMQRVLKYHLLLQELVKHTTDLTEKANLKLALDAMKDLAQYVNEVKRDNETLREIKQFQ
LSIENLNQPVLLFGRPQGDGEIRITTLDKHTKQERHIFLFDLAVIVCKRKGDNYEMKEII
DLQQYKIANNPTTDKENKKWSYGFYLIHTQGQNGLEFYCKTKDLKKKWLEQFEMALSNIR
PDYADSNFHDFKMHTFTRVTSCKVCQMLLRGTFYQGYLCFKCGARAHKECLGRVDNCGRV
NSGEQGTLKLPEKRTNGLRRTPKQVDPGLPKMQVIRNYSGTPPPALHEGPPLHLQAGDTV
ELLKGDAHSLFWQGRNLASGEVGFFPSDAVKPCPCVPKPVDYSCQPWYAGAMERLQAETE
LINRVNSTYLVRHRTKESGEYAISIKYNNEAKHIKILTRDGFFHIAENRKFKSLMELVEY
YKHHSLKEGFRTLDTTLQFPYKEPEHSAGQRGNRAGNSSLNTKVLGIAIARYDFCARDMR
ELSLLKGDVVKIYTKMSANGWWRGEVNGRVGWFPSTYVEEDE
Download sequence
Identical sequences ENSGGOP00000001867 ENSGGOP00000016866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]