SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001985 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001985
Domain Number 1 Region: 65-315
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.38e-50
Family Tyrosine-dependent oxidoreductases 0.000000000277
Further Details:      
 
Domain Number 2 Region: 352-503
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 1.66e-49
Family MaoC-like 0.000000106
Further Details:      
 
Domain Number 3 Region: 508-626
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 9.32e-32
Family MaoC-like 0.000000569
Further Details:      
 
Domain Number 4 Region: 646-758
Classification Level Classification E-value
Superfamily SCP-like 1.34e-31
Family Sterol carrier protein, SCP 0.0000025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001985   Gene: ENSGGOG00000002010   Transcript: ENSGGOT00000002027
Sequence length 761
Comment pep:novel chromosome:gorGor3.1:5:102636419:102721175:1 gene:ENSGGOG00000002010 transcript:ENSGGOT00000002027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVILEAPNLLRRKEPETPGLSSRIGPSLCPGFCRKRSVSCCFQNLCNNPMEKIISQCRFF
VSMNDLGGDFKGVGKGSLAADKVVEEIRRRGGKAVANYDSVEEGEKVVKTALDAFGRIDV
VVNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVTRAAWEHMKKQKYGRIIMTSSASGI
YGNFGQANYSAAKLGLLGLANSLAIEGRKSNIHCNTIAPNAGSRMTQTVMPEDLVEALKP
EYVAPLVLWLCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRQKNHPMTPEAVKANWKK
ICDFENASKPQSIQESTGSIIEVLSKIDSEGGVSANHTSRATSTATSGFAGAIGQKLPPF
SYAYTELEAIMYALGVGASIKDPKDLKFIYEGSSDFSCLPTFGVIIGQKSMMGGGLAEIP
GLSINFAKVLHGEQYLELYKPLPRAGKLKCEAVVADVLDKGSGVVIIMDVYSYSEKELIC
HNQFSLFLVGSGGFGGKRTSDKVKVAVAIPNRPPDAVLTDTTSLNQAALYRLSGDWNPLH
IDPNFASLAGFDKPILHGLCTFGFSARRVLQQFADNDVSRFKAIKARFAKPVYPGQTLQT
EMWKEGNRIHFQTKVQETGDIVISNAYVDLAPTSDTSAKIPSEGGKLQSTFVFEEIGRRL
KDIGPEVVKKVNAVFEWHITKGGNIGAKWTIDLKSGSGKVYQGPAKGAADTTIILSDEDF
MEVVLGKLDPQKAFFSGRLKARGNIMLSQKLQMILKDYAKL
Download sequence
Identical sequences G3QHZ6
ENSGGOP00000001985 ENSGGOP00000001985 XP_004042441.2.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]