SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002218 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002218
Domain Number 1 Region: 397-611
Classification Level Classification E-value
Superfamily L domain-like 1.47e-36
Family Ngr ectodomain-like 0.0067
Further Details:      
 
Domain Number 2 Region: 47-280
Classification Level Classification E-value
Superfamily L domain-like 2.24e-33
Family Ngr ectodomain-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002218   Gene: ENSGGOG00000002256   Transcript: ENSGGOT00000002266
Sequence length 977
Comment pep:novel chromosome:gorGor3.1:3:165984999:165994936:-1 gene:ENSGGOG00000002256 transcript:ENSGGOT00000002266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPSIAEMLHRGRMLWIILLSTIALGWTTPIPLIEDSEEIDEPCFDPCYCEVKESLFHIH
CDSKGFTNISQITEFWSRPFKLYLQRNSMRKLYTNSFLHLNNAVSINLGNNALQDIQTGA
FNGLKILKRLYLHENKLDVFRNDTFLGLESLEYLQADYNVIKRIESGAFRNLSKLRVLIL
NDNLIPMLPTNLFKAVSLTHLDLRGNRLKVLFYRGMLDHIGRSLMELQLEENPWNCTCEI
VQLKSWLERIPYTALVGDITCETPFHFHGKDLREIRKTELCPLLSDSEVEASLGIPHSSS
SKENAWPTKPSSMLSSVHFTASSVEYKSSNKQPKPTKQPRTPRPPSTSQALYPGPNQPPI
APYQTRPPIPIICPTGCTCNLHINDLGLTVNCKERGFNNISELLPRPLNAKKLYLSSNLI
QKIYRSDFWNFSSLDLLHLGNNRISYVQDGAFINLPNLKSLFLNGNDIEKLTPGMFRGLQ
SLHYLYFEFNVIREIQPAAFSLMPNLKLLFLNNNLLRTLPTDAFAGTSLARLNLRKNYFL
YLPVAGVLEHLNAIVQIDLNENPWDCTCDLVPFKQWIETISSVSVVGDVLCRSPENLTHR
DVRTIELEVLCPEMLHVAPAGESPAQPGDSHLIGAPTSASPYEFSPPGGPVPLSVLILSL
LVLFFSAVFVAAGLFAYVLRRRRKKLPFRSKRQEGVDLTGIQMQCHRLFEDGGGGGGGSG
GGGRPTLSSPEKAPPVGHVYEYIPHPVTQMCNNPIYKPREEEEVAVSSAQEAGSAERGGP
GTQPPGMGEALPGSEQFAETPKENHSNYRTLLEKEKEWALAVSSSQLNTIVTVNHHHPHH
PAVGGVSGVVGGTGGDLAGFRHHEKNGGVVLFPPGGGCGGGSMLLDRERPQPAPCTVGFV
DCLYGTVPKLKELHVHPPGMQYPDLQQDARLKETLLFSAGKGFTDHQTQKSDYLELRAKL
QTKPDYLEVLEKTTYRF
Download sequence
Identical sequences G3QIK7
ENSGGOP00000002218 XP_004038008.1.27298 XP_004038009.1.27298 XP_018878434.1.27298 ENSGGOP00000002218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]