SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002697 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002697
Domain Number 1 Region: 61-257
Classification Level Classification E-value
Superfamily EF-hand 7.33e-25
Family Calmodulin-like 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002697   Gene: ENSGGOG00000002737   Transcript: ENSGGOT00000002751
Sequence length 266
Comment pep:novel chromosome:gorGor3.1:12:116778288:116841214:-1 gene:ENSGGOG00000002737 transcript:ENSGGOT00000002751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPRSGPTRNPRLRAFAGVPTRGRTRGQSRRCAAEASAGPERDARPGAPAAGTMGAAHSAS
EEVRELEGKTGFSSDQIEQLHRRFKQLSGDQPTIRKENFNNVPDLELNPIRSKIVRAFFD
NRNLRKGPSGLADEINFEDFLTIMSYFRPIDTTMDEEQVELSRKEKLRFLFHMYDSDSDG
RITLEEYRNVVEELLSGNPHIEKESARSIADGAMMEAASVCMGQMEPDQVYEGITFEDFL
KIWQGIDIETKMHVRFLNMETMALCH
Download sequence
Identical sequences ENSGGOP00000002697 ENSGGOP00000002697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]