SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003047 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003047
Domain Number 1 Region: 7-34,74-148
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.19e-25
Family Voltage-gated potassium channels 0.0037
Further Details:      
 
Domain Number 2 Region: 141-261
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.71e-24
Family Voltage-gated potassium channels 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003047   Gene: ENSGGOG00000003100   Transcript: ENSGGOT00000003115
Sequence length 374
Comment pep:novel chromosome:gorGor3.1:8:139678987:139771363:-1 gene:ENSGGOG00000003100 transcript:ENSGGOT00000003115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRQNVRTLSLIVCTFTYLLVGAAVFDALESDHEMREEEKLKAEEIRIKGKYNISSEDYR
QLELVILQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPL
TLVMFQSLGERMNTFVRYLLKRIKKCCGMRNTDVSMENMVTVGFFSCMGTLCIGAAAFSQ
CEEWSFFHAYYYCFITLTTIGFGDYVALQTKGALQKKPLYVAFSFMYILVGLTVIGAFLN
LVVLRFLTMNSEDERRDAEERASLAGNRNSMVIHIPEEPRPSRPRYKADVPDLQSVCSCT
CYRSQDYGGRSVAPQNSFSAKLAPHYFHSISYKIEEISPSTLKNSLFPSPISSISPGLHS
FTDHQRLMKRRKSV
Download sequence
Identical sequences A0A024R9H3 A0A2I2ZP69 A0A2I3TUP5 A0A2J8SB11 G1QL17 Q9NPC2
ENSNLEP00000001629 ENSP00000302166 ENSGGOP00000003047 ENSP00000302166 ENSP00000429847 ENSP00000430676 ENSPTRP00000035253 9598.ENSPTRP00000035253 9600.ENSPPYP00000021207 9606.ENSP00000302166 ENSNLEP00000001629 gi|7706135|ref|NP_057685.1| ENSP00000302166 ENSP00000429847 ENSP00000430676 ENSPTRP00000035253 NP_001269463.1.87134 NP_001269463.1.92137 XP_002819512.1.23681 XP_003276770.1.23891 XP_004047616.1.27298 XP_009454253.1.37143 XP_009454254.1.37143 XP_011515404.1.92137 XP_018888367.1.27298 XP_018888368.1.27298 XP_519977.2.37143 ENSGGOP00000003047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]