SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003349 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003349
Domain Number 1 Region: 388-612
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.88e-34
Family Calponin-homology domain, CH-domain 0.00034
Further Details:      
 
Domain Number 2 Region: 85-242,380-462
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.8e-22
Family FAD/NAD-linked reductases, N-terminal and central domains 0.061
Further Details:      
 
Domain Number 3 Region: 723-754
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000784
Family LIM domain 0.00055
Further Details:      
 
Domain Number 4 Region: 689-722
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000884
Family LIM domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003349   Gene: ENSGGOG00000003401   Transcript: ENSGGOT00000003425
Sequence length 1067
Comment pep:novel chromosome:gorGor3.1:6:109519397:109531781:-1 gene:ENSGGOG00000003401 transcript:ENSGGOT00000003425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPTSTNPAHAHFESFLQAQLCQDVLSSFQELCGALGLEPGGGLPQYHKIKDQLNYWSA
KSLWTKLDKRAGQPVYQQGRACASTKCLVVGAGPCGLRVAVELALLGARVVLVEKRTKFS
RHNVLHLWPFTIHDLRALGAKKFYGRFCTGTLDHISIRQLQLLLLKVALLLGVEIHWGVT
FTGLQPPPRKGSGWHAQLQPNPPAQLANYEFDVLISAAGGKFVPEGFKVREMRGKLAIGI
TANFVNGRTVEETQVPEISGVARIYNQSFFQSLLKATGIDLENIVYYKDDTHYFVMTAKK
QCLLRLGVLRQDWPDTDRLLGSANVVPEALQRFARAAADFATHGKLGKLEFAQDAHGQPD
VSAFDFTSMMRAESSARVQEKHGARLLLGLVGDCLVEPFWPLGTGVARGFLAAFDAAWMV
KRWAEGAESLEVLAERESLYQLLSQTSPENMHRNVAQYGLDPATRYPNLNLRAVTPNQVR
DLYDVLAKEPVQRNNDKTDTGMPATGSAGTQEELLRWCQEQTAGYPGVHVSDLSSSWADG
LALCALVHRLQPDLLEPSELQGLGALEATVWALKVAENELGITPVVSAQAVVAGSDPLGL
IAYLSHFHSAFKSTAHSPGPVSQASPGTSSAVLFLSKLQRTLQRSRAKENAEDAGGKKLR
LEMEAETPSTEVPPHPEPGVPLTPPSQHQEAGAGDLCALCGEHLYVLERLCVNGRFFHRS
CFRCHTCEATLWPGGYEQHPGDGHFYCLQHLPQPDHKEEGSDRGPESPELPTPSENSMPP
GLSTPTASQEGAGPVPDPSQSTRRQIRLSSPERQRLSSLNLTPDPEMEPPPKPPRSCSAL
ARHALESSFVGWGLPVQSPQALVAMEKEEKESPFSSEEEEEDVPLDSDVEQALQTFAKTS
GTMNNYPTWRQTLLRRAKEEEMKRFCKAQTIQRRLNEIEAALRELEAEGVKLELALRRQS
SSPEQQKKLWVGQLLQLVDKKNSLVAEEAELMITVQELNLEEKQWQLDQELRGYMNREET
LKTAADRQAEDQVLRKLVDLVNQRDALIRFQEERRLSELALGTGAQG
Download sequence
Identical sequences ENSGGOP00000003349 ENSGGOP00000003349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]