SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003719 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003719
Domain Number 1 Region: 67-245
Classification Level Classification E-value
Superfamily HAD-like 8.84e-61
Family NLI interacting factor-like phosphatase 0.000000083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003719   Gene: ENSGGOG00000003784   Transcript: ENSGGOT00000003806
Sequence length 250
Comment pep:novel chromosome:gorGor3.1:3:38975588:39013639:1 gene:ENSGGOG00000003784 transcript:ENSGGOT00000003806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASQCNVSLKKQRSRSILSSFFCCFRDYNVEAPPPSSPSVLPPLVEENGGLQKGDQRQVIP
IPSPPAKYLLPEVTVLDYGKKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTIHQVYVL
KRPHVDEFLQRMGQLFECVLFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVK
DLSRLGRELSKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFEGLSREDDV
YSMLHRLCNR
Download sequence
Identical sequences ENSGGOP00000003719 ENSNLEP00000006223 ENSGGOP00000003719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]