SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003788 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003788
Domain Number 1 Region: 260-337
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.22e-23
Family Intermediate filament protein, coiled coil region 0.00036
Further Details:      
 
Domain Number 2 Region: 72-138
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000309
Family Intermediate filament protein, coiled coil region 0.0045
Further Details:      
 
Domain Number 3 Region: 36-60
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000523
Family Intermediate filament protein, coiled coil region 0.0026
Further Details:      
 
Domain Number 4 Region: 153-261
Classification Level Classification E-value
Superfamily Prefoldin 0.0000915
Family Prefoldin 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003788   Gene: ENSGGOG00000003858   Transcript: ENSGGOT00000003881
Sequence length 459
Comment pep:novel chromosome:gorGor3.1:12:50810936:50817007:-1 gene:ENSGGOG00000003858 transcript:ENSGGOT00000003881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRQASKTSGGGSQGFSGRSAVVSGSSRMSCVARSGKFASFIDKVRFLEQQNKVLETKWN
LLQQQGTSSISGTNNLEPLFENHINYLRSYLDNILGERGRLDSELKNMEDLVEDFKKKYE
DEINKRTAAENEFVTLKKDVDSAYMNKVELQAKVDALIDEIDFLRTLYDAELSQMQSHIS
DTSVVLSMDNNRSLDLDSIIAEVRAQYEDITQRSKAEAEALYQTKLGELQTTAGRHGDDL
RNTKSEIIELNRMIQRLQAEIEGVKKQNANLQTAIAEAEQHGEMALKDANAKLQELQAAL
QQAKDDLARLLRDYQELMNVKLALDVEIATYRKLLEGEEYSRMSGECPSAVSISVVSSST
TSASAGGYGGGYGGGLGGGLGGGFSAGGGSGSGFGRGGGGGIGGGFVGGSSSGFSGGSGF
GSISGARYGVSGGGFSSASNRGGSIKFSQSSQSSQRYSR
Download sequence
Identical sequences ENSGGOP00000003788 ENSGGOP00000003788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]