SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003919 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003919
Domain Number 1 Region: 32-150
Classification Level Classification E-value
Superfamily Hormone receptor domain 5.23e-31
Family Hormone receptor domain 0.0022
Further Details:      
 
Domain Number 2 Region: 109-411
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000201
Family Rhodopsin-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003919   Gene: ENSGGOG00000003991   Transcript: ENSGGOT00000004016
Sequence length 462
Comment pep:novel chromosome:gorGor3.1:2b:75519085:75624504:-1 gene:ENSGGOG00000003991 transcript:ENSGGOT00000004016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEKKYTLYFLVLLPFFMILVTAELEESPEDSIQLGVTRNKIMTAQYECYQKIMQDPIQQ
AEGVYCNRTWDGWLCWNDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNR
TWTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLLISLGIFFYFKSLSCQRITLHKN
LFFSFVCNSVVTIIHLTAVANNQALVATNPVSCKVSQFIHLYLMGCNYFWMLCEGIYLHT
LIVVAVFAEKQHLMWYYFLGWGFPLIPACIHAIARSLYYNDNCWISSDTHLLYIIHGPIC
AALLVNLFFLLNIVRVLITKLKVTHQAESNLYMKAVRATLILVPLLGIEFVLIPWRPEGK
IAEEVYDYIMHILMHFQGLLVSTIFCFFNGEVQAILRRNWNQYKIQFGNSFSNSEALRSA
SYTVSTISDGPGYSHDCPSEHLNGKSIHDIENVLLKPENLYN
Download sequence
Identical sequences ENSGGOP00000003919 ENSGGOP00000003919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]