SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004162 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004162
Domain Number 1 Region: 25-150
Classification Level Classification E-value
Superfamily Hormone receptor domain 6.15e-28
Family Hormone receptor domain 0.00032
Further Details:      
 
Domain Number 2 Region: 145-413
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 8.97e-16
Family Rhodopsin-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004162   Gene: ENSGGOG00000004243   Transcript: ENSGGOT00000004265
Sequence length 460
Comment pep:novel chromosome:gorGor3.1:3:43540711:43575765:1 gene:ENSGGOG00000004243 transcript:ENSGGOT00000004265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPPSPLPARWLCVLAGALACALGPAGGQAARLQEECDYVQMIEVQHKQCLEEAQLENET
IGCSKMWDNLTCWPATPRGQVVVLACPLIFKLFSPIQGRNVSRSCTDEGWTHLEPGPYPI
ACGLDDKAASLDEQQTMFYGSVKTGYTIGYGLSLATLLVATAILSLFRKLHCTRNYIHMH
LFISFILRAAAVFIKDLALFDSGESDQCSEGSVGCKAAMVFFQYCVMANFFWLLVEGLYL
YTLLAVSFFSERKYFWGYILIGWGLTGVPSTFTIVWTIARIHFEDYGCWDTINSSLWWII
KGPILTSILVNFILFICIIRILLQKLRPPDIRKSDSSPYSRLARSTLLLIPLFGVHYIMF
AFFPDNFKPEVKMVFELVVGSFQGFVVAILYCFLNGEVQAELRRKWRRWHLQGVLGWNPK
YRHPSGGSNGATCSTQVSMLTRVSPGARRSSSFQAEVSLV
Download sequence
Identical sequences ENSGGOP00000004162 ENSGGOP00000004162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]