SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004275 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004275
Domain Number 1 Region: 146-253
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000123
Family cAMP-binding domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004275   Gene: ENSGGOG00000004357   Transcript: ENSGGOT00000004379
Sequence length 364
Comment pep:novel chromosome:gorGor3.1:3:119200291:119220702:-1 gene:ENSGGOG00000004357 transcript:ENSGGOT00000004379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSANSSRVGQLLLQGSACISWKQDVEGAVYHLANCLLLLGFMGGSGVYGCFYLFGFLSAG
YLCCVLWGWFSACGLDIVLWSFLLAVVCLLQLAHLVYRLREDTLPEEFDLLYKTLCLPLQ
VPLQTYKEIVHCCEEQVLTLATEQTYAVEGETPINRLSLLLSGRVRVSQDGQFLHYIFPY
QFMDSPEWESLQPSEEGVFQVTLTAETSCSYISWPRKSLHLLLTKERYISCLFSALLGYD
ISEKLYTLNDKLFAKFGLRFDIRLPSLYHVLGPTAADAGPESEKGDEEVCEPAVSHPQAT
PTSLQQTPPCFTPPATTNFPAPPTRARLSRPDSGILASRIPLQSYSQVISRGQAPLAPTH
TPEL
Download sequence
Identical sequences XP_004036169.1.27298 ENSGGOP00000004275 ENSGGOP00000004275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]