SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004503 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004503
Domain Number 1 Region: 25-169
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.9e-31
Family Dual specificity phosphatase-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004503   Gene: ENSGGOG00000004596   Transcript: ENSGGOT00000004618
Sequence length 340
Comment pep:novel chromosome:gorGor3.1:1:140839322:140848255:1 gene:ENSGGOG00000004596 transcript:ENSGGOT00000004618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEAPGPSDGCELSNPSASRVSCAGQMLEVQPGLYFGGAAAVAEPDHLREAGITAVLTVD
SEEPSFKAGPGVEDLSRLFVPALDKPETDLLSHLDRCVAFIGQARAEGRAVLVHCHAGVS
RSVAIITAFLMKTDQLPFEKAYEKLQILKPEAKMNEGFEWQLKLYQAMGYEVDTSSAIYK
QYRLQKVTEKYPELQNLPQELFAVDPTTVSQGLKDEVLYKCRKCRRSLFRSSSILDHHEG
SGPIAFAHKRMTPSSMLTTGRQAQCTSYFIEPVQWMESALLGVMDGQLLCPKCSAKLGSF
NWYGEQCSCGRWITPAFQIHKNRVDEMKILPVLGSQTRKI
Download sequence
Identical sequences G3QPK6
ENSGGOP00000004503 ENSGGOP00000004503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]