SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004612 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004612
Domain Number 1 Region: 217-458
Classification Level Classification E-value
Superfamily SMAD/FHA domain 4.41e-97
Family SMAD domain 0.00000000297
Further Details:      
 
Domain Number 2 Region: 31-80,111-171
Classification Level Classification E-value
Superfamily SMAD MH1 domain 2.22e-42
Family SMAD MH1 domain 0.000000888
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004612   Gene: ENSGGOG00000004706   Transcript: ENSGGOT00000004732
Sequence length 467
Comment pep:novel chromosome:gorGor3.1:18:45491510:45544363:-1 gene:ENSGGOG00000004706 transcript:ENSGGOT00000004732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDE
LEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLV
PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQS
MDTGKKMSLSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVD
GFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSP
NCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVK
GWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS
Download sequence
Identical sequences ENSGGOP00000004612 ENSGGOP00000004612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]