SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004648 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004648
Domain Number 1 Region: 45-754
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.95e-265
Family Motor proteins 0.000000000486
Further Details:      
 
Domain Number 2 Region: 2060-2176
Classification Level Classification E-value
Superfamily Second domain of FERM 2.09e-21
Family Second domain of FERM 0.0036
Further Details:      
 
Domain Number 3 Region: 2177-2251
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000012
Family Third domain of FERM 0.026
Further Details:      
 
Domain Number 4 Region: 1960-2067
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000031
Family Ras-binding domain, RBD 0.032
Further Details:      
 
Domain Number 5 Region: 1231-1324
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000000772
Family Second domain of FERM 0.0065
Further Details:      
 
Domain Number 6 Region: 1137-1239
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000105
Family Ubiquitin-related 0.042
Further Details:      
 
Domain Number 7 Region: 1689-1750
Classification Level Classification E-value
Superfamily SH3-domain 0.000000185
Family SH3-domain 0.0026
Further Details:      
 
Domain Number 8 Region: 761-827
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000159
Family Motor proteins 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004648   Gene: ENSGGOG00000004731   Transcript: ENSGGOT00000004768
Sequence length 2252
Comment pep:novel chromosome:gorGor3.1:2b:14539482:14620716:1 gene:ENSGGOG00000004731 transcript:ENSGGOT00000004768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGFRLGDHVWLEPPSTHKTGVAIGGIIKEAKPGKVSVEDGEGKEHWIRAEDFGVLSPMH
PNSVQGVDDMIRLGDLNEAGMVHNLLIRYQQHKIYTYTGSILVAVNPFQVLPLYTLEQVQ
LYYSRHMGELPPHVFAIANNCYFNMKRNKRDQCCIISGESGAGKTETTKLILQFLATISG
QHSWIEQQVLEANPILEAFGNAKTIRNDNSSRFGKYIDIYFNPSGVIEGARIEQFLLEKS
RVCRQAPEERNYHIFYCMLMGMSAEDKQLLSLGTPSEYHYLTMGNCTSCEGLNDAKDYAH
IRSAMKILQFSDSESWDITKLLATILHLGNVGFMASVFENLDASDVMETPAFPTVMKLLE
VQHQELRDCLIKHTILIRGEFVTRPLNIAQAADRRDAFVKGIYGHLFLWIVKKINAAIFT
PPAQDPRNVRRAIGLLDIFGFENFENNSFEQLCINFANEHLQQFFVQHVFTMEQEEYRSE
NISWDYIHYTDNRPTLDLLALKPMSIISLLDEESRFPQGTDLTMLQKLNSIHANNKAFLQ
PKNIHDARFGIAHFAGEVYYQAESADSNKRPSTLGSQFKQSLDQLMKILTNCQPYFIRCI
KPNEYKKPLLFDRELCLRQLRYSGMMETVHIRKSGFPIRYTFEEFSQRFGVLLPNAMRMQ
LRGKFRQMTLGITDVWLRTDKDWKVGKTKIFLKDHQDTLLEVQRSQVLDRAALSIQKVLR
GYRYRKEFLRQRRAAVTLQAWWRGYCNRRNFKLILVGFERLQAIARSQLLARQYQAMRQR
TVQLQALCRGYLVRQQVQAKRRAVVVIQAHARGMAARRNFRQRKANAPLVIPAEGQKSQG
ALPAKKRRSIYDTVTDTEMVEKVFGFLPAMIGGQEGQASPRFEDLESKTQKLLEVDLDTV
PMAEEPEEDVDGLAEYTFPKFAVTYFQKSASHTHIRRPLRYPLLYHEDDTDCLAALVIWN
VILRFMGDLPEPVLYARSSQQGSSVMRQIHDTLGREHGAQVPQHSRSAQVASQLNIGEEA
LEPNGLGADRPMSNLEKVHFIVGYAILRPSLRDEIYCQICKQLSENFKTSSLARGWILLS
LCLGCFPPSERFMKYLLNFIGQGPATYGPFCAERLRRTYANGVRAEPPTWLELQAVKSKK
HIPIQVILATGESLTVPVDSASTSREMCMHIAHKQGLSDHLGFSLQVAVYDKFWSLGSGR
DHMMDAIAQCEQMAQEKGESQRQSPWRIYFRKEFFTPWHDSREDPVSTELIYRQVLHGVW
SGEYSFEKEEELVELLARHCYVQLGASAESKAVQELLPSCIPHKLYRTKPPDRWASLVTA
ACAKAPYTQKQATPLAVREQVVDAARLQWPLLFSRLFEVITLSAFTLPSLLARPPPAQDA
GPAGEDAAGTLFPRGHGSGHQQVRALREDLFLHPEPHPPAPGCTAHEVLHWGITHCTGSF
SLKPRSTRKGQGSVQPLAGTYLEGSFLCHGRELVAWRVQVVWESDKGQCLAGADPHSHGS
PWLSLTGNFSMPFGKSTRQSGTCISGLCQVYSGHHSPLATSQPRSTDSITHSAMSKLKHA
EVRWLRVSTWQSRQLISALTFAVSLRCHCTPATSLSAHSQPHTWAAPLSASRPTVVSGLV
LALAEQLCVLMRWRGLLVTLPFISREAQGGQRLLLSTMHEEYEFVSPSSVAIAELVALFL
EGLKERSIFAMALQDRKATDDTTLLAFKKGDLLVLTKKQGLLASENWTLGQNDRTGKTGL
VPMACLYTIPTVTKPSAQLLSLLAMSPEKRKLAAQEGQFTEPCPEEPPAPEKDMVSMAML
PLARARGHLWAYSSEPLRQPLLKRVHANVDLWDIACQIFATPILRYMGDYPSRQAWPTLE
LTDQIFTLALQHPALQDEVYCQILKQLTHNSNRHSEERGWQLLWLCTGLFPPSKGLLPHA
QKFIDTRRGKLLAPDCSRRIQKVLRTGPRKQPPHQVEVEAAEQNVSRICHKIYFPNDTSE
VLEVVANTRVRDVCDSIATRLQLASWEGCSLFIKISDKVISQKEGDFFFDSLRQVSDWVK
KNKPQKEGAPVMLPYQVYFMRKLWLNISPGKDVNADTILHYHQELPKYLRGFHKCSREDA
IHLAGLIYKAQFNNDRSQLASVPKILRELVPENLTRLMSSEEWKKSILLAYDKHKDKTVE
EAKVAFLKWICRWPTFGSAFFEVKQTSEPSYPDVILIAINRHGVLLIHPKTKDLLTTYPF
TKISSWSSGSTYFHMVLGSLGRGSRLLCETSL
Download sequence
Identical sequences ENSGGOP00000004648 ENSGGOP00000004648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]