SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004684 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004684
Domain Number 1 Region: 10-172
Classification Level Classification E-value
Superfamily RUN domain-like 2.35e-40
Family RUN domain 0.00066
Further Details:      
 
Domain Number 2 Region: 1362-1476
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 3.01e-29
Family Supernatant protein factor (SPF), C-terminal domain 0.0012
Further Details:      
 
Domain Number 3 Region: 1169-1233
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.45e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0014
Further Details:      
 
Domain Number 4 Region: 867-1073
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000556
Family Tropomyosin 0.00056
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000004684
Domain Number - Region: 481-555
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00288
Family Myosin rod fragments 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004684   Gene: ENSGGOG00000004777   Transcript: ENSGGOT00000004804
Sequence length 1478
Comment pep:novel chromosome:gorGor3.1:3:47144430:47223347:-1 gene:ENSGGOG00000004777 transcript:ENSGGOT00000004804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASTNAESQLQRIIRDLQDAVTELSKEFQEAGEPITDDSTSLHKFSYKLEYLLQFDQKEK
ATLLGNKKDYWDYFCACLAKVKGANDGIRFVKSISELRTSLGKGRAFIRYSLVHQRLADT
LQQCFMNTKVTSDWYYARSPFLQPKLSSDIVGQLYELTEVQFDLASRGFDLDAAWPTFAR
RTLTTGSSAYMWKPPSRSSSMSSLVSSYLQTQEMVSNFDLNSPLNNEALEGFDEMRLELD
QLEVREKQLQERMQQLDRENQELRAAVSLQGEQLQTERERGRTAAEDNVRLTCLVAELQK
QWEVTQAIQNTVKELQTCLQALELGAAEKEEDYHTALRRLESMLQPLAQELEATWDSLGK
KNQHLASFPGCLAMAQQKADTASDTKGRQEPIPSDAAQEIQELGEKLQALERERTKVEEV
NRQQSAQLEQLVKELQLKEDARASLERLVKEMAPLQEELSGKGQEADQLWRRLQELLAHT
SSWEEELAELRREKKQQQEEKELLEQEVRSLTRQLQFLETQLAQVSQHVSDLEEQKKQLI
QDKDHLSQQVGTLERLAGPPGPELPVAGEKNEALVPVNSSLQEACGKPEEEQRGLQEAQL
DDTKVQEGSQEEELRQANRELEKELQNVVGRNQLLEGKLQALQADYQALQQRESAIQGSL
ASLEAEQASIRHLGDQMEASLLAVRKAKEAMKAQMAEKEATLQSKEGECQQLREEVEQCR
HLAEARHRELRALESQCQQQTQLIEVLTAEKGQQGVGPPTDNEARELAAQLALSQAQLEV
HQGEAQRLQAQVVDLQAKMRAALDDQDKVQSQLSMAEAVLREHKTLVQQLKEQNEALNRA
HVQELLQCSEREGALQEERADEAQQREEKLRALQEELSQAKCSSEEAQLEHAELQEQLHR
ANTDTAELGIQVCALTMEKERVEEALACAVQELQDAKEAASREREGLERQVAGLQQEKES
LQEKLKAAKAAAGSLPGLQAQLAQAEQRAQSLQEAAHQELDTLKFQLSAEIMDYQSRLKN
AGEECKSLRGQLEEQGRQLQAAEEAVEKLKATQADMGEKLSCTSTHLAECQAAMLRKDKE
GAALREDLERTQKELEKATTKIQEYYNKLCQEVTNRERNDQKMLADLDDLNRTKKYLEER
LIELLRDKDALWQKSDALEFQQKLSAEERWLGDTEANHCLDCKREFSWMVRRHHCRICGR
IFCYYCCNNYVLSKHSGKKERCCRACFQKLSEGPGSPDSSGSGTSQGEPSPALSPASPGP
QATGGQGANTDYRPPDDAVFDIITDEELCQIQESGSSLPETPTETDSLDPNVAEQDTTST
SLTPEDTEDMPLGQDSEICLLKSGELMIKVPLTVDEIASFGEGSRELFVRSSTYSLIPIT
VAEAGLTISWVFSSDPKSISFSVVFQEAEDTPLDQCKVLIPTTRCNSHKENIQGQLKVRT
PGIYMLIFDNTFSRFVSKKVFYHLTVDRPVIYDGSDFL
Download sequence
Identical sequences G3QQ26
ENSGGOP00000004684 ENSGGOP00000004684 XP_004034048.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]