SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004705 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004705
Domain Number 1 Region: 218-252
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000572
Family Tudor domain 0.017
Further Details:      
 
Domain Number 2 Region: 174-199
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000675
Family CCCH zinc finger 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004705   Gene: ENSGGOG00000004801   Transcript: ENSGGOT00000004825
Sequence length 531
Comment pep:novel chromosome:gorGor3.1:20:61967292:61996179:1 gene:ENSGGOG00000004801 transcript:ENSGGOT00000004825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEESLESALQTYRAQLQQVELALGAGLDSSEQADLRQLQGDLKELIELTEASLVSVRKS
RLLAALDEERPGRQEDAEYQAFREAITEAVEAPAAARGSGSETVPKAEAGPESAAGGQEE
EEGEDEEELSGTKVSAPYYSSWGTLEYHNAMVVGTEEAEDGSAGVRVLYLYPTHKSLKPC
PFFLEGKCRFKENCRFSHGQVVSLDELRPFQDPDLSSLQAGSSCLAKHQDGLWHAARITD
VDNGYYTVKFDSLLLREAVVEGDGILPPLRTEATESDSDSDGTGDSSYARVVGSDAVDSA
QSSALCPSLVVVGSDAVDSGTCSSAFAGWEVHTRGIGSRLLTKMGYEFGKGLGRHAEGRV
EPIHAVVLPRGKSLDQCVETLQKQTRVGKAGTNKPPRCRGRGARPGGRPAPRNVFDFLNE
KLQGQAPGALEAGAAPAGRRSKDMYRASKSAKRALSLRLFQTEEKIERTQRDIRSIQEAL
ARNAGRHSVASAQLQEKLAGAQRQLGQLRAQEAGLQQEQRKADTHKKMTEF
Download sequence
Identical sequences G3QQ47
ENSGGOP00000004705 ENSGGOP00000018406 XP_018872315.1.27298 ENSGGOP00000004705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]